KEGG   Panthera tigris altaica (Amur tiger): 102967279
Entry
102967279         CDS       T02988                                 

Gene name
HSD11B1
Definition
(RefSeq) hydroxysteroid 11-beta dehydrogenase 1
  KO
K15680  corticosteroid 11-beta-dehydrogenase isozyme 1 [EC:1.1.1.146]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Module
ptg_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102967279 (HSD11B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102967279 (HSD11B1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102967279 (HSD11B1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.146  11beta-hydroxysteroid dehydrogenase
     102967279 (HSD11B1)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C Shikimate_DH DUF1776 NAD_binding_2 2-Hacid_dh_C ApbA NAD_binding_7 Pyr_redox_3 ADH_zinc_N Helicase_RecD
Other DBs
NCBI-GeneID: 102967279
NCBI-ProteinID: XP_007096202
LinkDB
Position
Un
AA seq 292 aa
MAFMKKYLPPILGIFLAYYYYSANEEFRPEMLQGKKVIVTGASKGIGEQMAYHLAKMGAH
VVVTARSKENLKKIVSHCLELGAASAHYIAGTMENMTFAEQFVAKAGKLMGGLDMLILNH
ITNTSMNLFSGDIHLVRRSMEVNFLSYVVLSATALPMLKQSNGSIVVVSSKAGKMASPLI
APYSASKFALDGFFSSIRMEHSVAKINVSITLCILGLINTDTAMKAISGIVNMEASPKEE
CALEIIKGGALRQEEVYYDNSVWTALLLGNPGRKILELFSLRSYSLDKFIIN
NT seq 879 nt   +upstreamnt  +downstreamnt
atggcttttatgaaaaaatatctcccccccattctggggatcttcttggcctactactac
tattctgcgaatgaggaattcagaccagagatgctccaaggaaagaaagtgattgtcaca
ggggccagcaaggggattggagaacagatggcctatcatctggcaaagatgggagcccat
gtggtggtgacagcaaggtctaaagaaaatctaaagaagatagtatcccattgcctggag
cttggagcagcctcagcacactacattgctggcaccatggagaatatgacctttgcagag
caatttgttgccaaagctggaaagctcatggggggactagacatgcttattctcaaccac
atcaccaacacttctatgaatctgtttagtggtgatatccacctcgtgcgcagaagcatg
gaagtcaacttcctcagttatgtggtcctgagtgctactgccttgcctatgctgaagcag
agcaacggaagcattgttgtcgtgtcctcgaaggctgggaaaatggctagtccacttatt
gcgccctattctgcaagcaagtttgccctggatgggtttttctcctccatcaggatggaa
cattcagtggccaagattaatgtatcgatcactctctgtatcctcggcctcataaacaca
gacacagccatgaaggccatttctggaatagtcaacatggaggcatctccaaaggaagaa
tgtgccctggagatcatcaaagggggagctctgcgccaagaggaagtgtactatgacaac
tcagtctggacagctctcctgctgggaaatccagggaggaagattctggaactcttctcc
ttaagaagttatagtttggacaagtttataatcaactaa

DBGET integrated database retrieval system