KEGG   Panthera tigris altaica (Amur tiger): 102967382
Entry
102967382         CDS       T02988                                 

Gene name
G6PD
Definition
(RefSeq) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00030  Pentose phosphate pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg05230  Central carbon metabolism in cancer
Module
ptg_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102967382 (G6PD)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102967382 (G6PD)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    102967382 (G6PD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102967382 (G6PD)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     102967382 (G6PD)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     102967382 (G6PD)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102967382 (G6PD)
  Exosomal proteins of colorectal cancer cells
   102967382 (G6PD)
  Exosomal proteins of bladder cancer cells
   102967382 (G6PD)
SSDB
Motif
Pfam: G6PD_N G6PD_C
Other DBs
NCBI-GeneID: 102967382
NCBI-ProteinID: XP_007099298
LinkDB
Position
Un
AA seq 283 aa
MAEQVALSRTQVCGILREELYQGNAFHRSDTHIFIIMGASGDLAKKKIYPTVWPEDTFSG
GYARSRLTVADIRKQSEPFFKATPEEKAKLEEFFAPRXVAGQYDDVASYRRLNSHVNGLH
QGPQTNRLFYLALPPTVYEAVTKNIHETCMSQTGWNRVIVEKPFGRDLQSSDRLSNHISS
LFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGY
FDEFGIIRDVMQNHLLQMLCLVAMEKPASTDSDDVRDEKGGAG
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcagagcaggtggccctgagccggacccaggtgtgcgggatcctgcgggaagagctg
taccagggcaatgccttccatcgatctgacacacatatcttcatcatcatgggtgcatcg
ggcgacctggccaagaagaagatctaccccaccgtctggcccgaagacaccttcagcggg
ggctacgcccgctcccgtctcacagtggccgacatccgcaagcagagcgagcccttcttc
aaagccacaccggaggagaaggccaagctggaggagttcttcgcccctcgtnaggtggct
ggccagtatgacgacgtggcgtcctacaggcgcctcaacagccacgtgaatggccttcac
caggggccgcagaccaaccgcctcttttacctggccttgccacccacggtctatgaggcg
gtcaccaagaacatccatgagacctgcatgagccagacaggctggaaccgtgtcattgtg
gagaagcccttcgggagggacctgcagagctctgaccggctatccaaccacatctcgtcc
ttattccgtgaggaccagatctaccgcatcgaccactacctgggcaaggagatggtgcag
aacctgatggtgctgagattcgccaacaggatctttggtcccatctggaaccgggacaac
atcgcctgtgtcatcctcactttcaaggagccctttggcaccgagggccgtggaggttac
ttcgatgaatttgggatcatccgggacgtgatgcagaaccacctcctgcagatgctgtgt
ctagtggccatggagaagcccgcctccactgactcggacgatgtccgcgacgagaagggg
ggtgcaggc

DBGET integrated database retrieval system