KEGG   Panthera tigris altaica (Amur tiger): 102967387Help
Entry
102967387         CDS       T02988                                 

Gene name
RFXAP
Definition
(RefSeq) regulatory factor X associated protein
  KO
K08063  regulatory factor X-associated protein
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04612  Antigen processing and presentation
ptg05152  Tuberculosis
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102967387 (RFXAP)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102967387 (RFXAP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102967387 (RFXAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFXA_RFXANK_bdg
Motif
Other DBs
NCBI-GeneID: 102967387
NCBI-ProteinID: XP_007097789
LinkDB All DBs
Position
Un
AA seq 290 aa AA seqDB search
MEKLIITVYAINATKTLWVSPVVNHDVMVLPRPLPGRTPARKGHCTVLKLLLLKAYLPVN
LHGWQGAADHQGAAAVLQDGLFQSRVADRTSLKDALYLLAWCDSQVNRQPRGKFKEEIFV
TAEEGIPLTEKAPEEAEGMRLSPGARRRGGGGGSMSKTCTFEGCSETTSQVAKQRKPWMC
KKHRNKMYKDKYKKKKSDQALNCSGAAQPGSAGNVRLEESTDNILSIVKQRTGTFGDRPA
RPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagaaactcataatcacagtctatgccatcaatgccacgaagacactgtgggtgtcc
cctgtcgtgaaccatgatgtcatggtgcttcccagacctcttccggggagaaccccagcc
aggaaaggtcactgcacagttttaaagttgctgctccttaaagcctatctacctgttaac
ctccatggctggcaaggggctgctgaccaccaaggggctgctgcagtcctccaggacggc
ctcttccagtcaagggttgcagacagaactagcctcaaagatgccctgtatctactcgcg
tggtgtgacagtcaagtaaatcggcagcccagaggcaagtttaaagaggagatatttgta
actgcagaggaaggcatacccttgacagagaaagctcctgaagaagctgaagggatgaga
ttgagcccaggagcccggagacggggtggcggcgggggcagcatgagcaagacctgcacc
ttcgagggctgcagcgagaccacgagccaggtggccaagcagcgcaagccttggatgtgc
aaaaaacaccgcaacaagatgtacaaggacaagtacaaaaagaagaaaagtgatcaggcc
ctgaactgcagtggggccgcccagcctggcagcgcgggaaacgtcagactggaggaaagt
acagataacatactctccattgttaaacaaagaacaggaacctttggggatcgtcctgca
agacccactcttttagaacaagtgttaaatcagaaaagactgtcattactaagaagtcca
gaagtggtgcaatttttacagaaacagcaacaactattaaatcagcaagttttggagcaa
agacagcagcagtttccaggaacatcagtgtga

DBGET integrated database retrieval system