KEGG   Panthera tigris altaica (Amur tiger): 102967404
Entry
102967404         CDS       T02988                                 

Gene name
CASP9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg04370  VEGF signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05134  Legionellosis
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05215  Prostate cancer
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102967404 (CASP9)
   04151 PI3K-Akt signaling pathway
    102967404 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102967404 (CASP9)
   04215 Apoptosis - multiple species
    102967404 (CASP9)
   04115 p53 signaling pathway
    102967404 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102967404 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967404 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102967404 (CASP9)
   05212 Pancreatic cancer
    102967404 (CASP9)
   05215 Prostate cancer
    102967404 (CASP9)
   05213 Endometrial cancer
    102967404 (CASP9)
   05222 Small cell lung cancer
    102967404 (CASP9)
   05223 Non-small cell lung cancer
    102967404 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102967404 (CASP9)
   05012 Parkinson disease
    102967404 (CASP9)
   05014 Amyotrophic lateral sclerosis
    102967404 (CASP9)
   05016 Huntington disease
    102967404 (CASP9)
   05020 Prion disease
    102967404 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    102967404 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102967404 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102967404 (CASP9)
   05152 Tuberculosis
    102967404 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102967404 (CASP9)
   05161 Hepatitis B
    102967404 (CASP9)
   05160 Hepatitis C
    102967404 (CASP9)
   05164 Influenza A
    102967404 (CASP9)
   05162 Measles
    102967404 (CASP9)
   05168 Herpes simplex virus 1 infection
    102967404 (CASP9)
   05163 Human cytomegalovirus infection
    102967404 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102967404 (CASP9)
   05169 Epstein-Barr virus infection
    102967404 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102967404 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102967404 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102967404 (CASP9)
   01002 Peptidases and inhibitors [BR:ptg01002]
    102967404 (CASP9)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     102967404 (CASP9)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102967404 (CASP9)
Peptidases and inhibitors [BR:ptg01002]
 Cysteine peptidases
  Family C14: caspase family
   102967404 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 102967404
NCBI-ProteinID: XP_007083850
LinkDB
Position
Un
AA seq 434 aa
GELQVASLWDALLTRQLFTPAMIEDIQHAGSGSRSDQVRQLVIDLETRGSQALPLFISCL
EDTGQDALASLLRMGRQAEKQNPQAVRPLDLMPVVVGPMGLKPEELRRRQYPLKPTPEKL
TPVVLGPEELWPAKLRPEVLRPEVPRPVDIGSGPFSDICAQEISKRNADLAYVLNADPCG
HCLIINNMNFCLESRLQTRTGSNIDCEKLQRRFSLLHFVVEVKHDQTAKQMVQALVELAR
RDHGALDCCVVVILSHGCQASHRQFPGAVYGTDGCPVSIEKIVNIFNGSGCPSLGGKPKL
FFIQACGGERKDHGVEVASTSPEDRTPGSDSEPDAVPFQEGPVTFDQPDAVSSLPTPSDI
FVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWARSEDLQTLLLRVANAVSQKGFYKQIP
GCFNFLRKKLYFKM
NT seq 1305 nt   +upstreamnt  +downstreamnt
ggcgagctgcaggtggcctcgctctgggacgctctgctgacccgccagctcttcacgccc
gcgatgatcgaggacatccagcatgcgggctcagggtctcggagcgatcaggtcaggcag
cttgtcatagatctagagacccgagggagtcaggcccttcctctgttcatctcctgctta
gaggacacaggccaggatgcgctggcttcattgctgagaatgggtcggcaagcagaaaag
cagaatccacaggccgtcagacccctggacctcatgcctgtggtggttggaccaatgggc
ctcaaaccagaggagctcagaaggaggcagtatcctttaaagccgactccggaaaaactc
actccagtggtgttggggcccgaggagctgtggccagccaagctgcggccagaggttctc
agaccagaggtgcctaggccagtggacattggttctggaccattcagtgatatctgtgct
caggaaatttcgaagcgaaatgctgatttggcgtatgtcctgaacgcggacccctgtggc
cactgcctcatcatcaacaacatgaacttctgcctcgagtcgaggctccagacccgtacc
ggctccaatatcgactgtgagaagttgcagcgacgtttctccttgctgcatttcgtggtg
gaggtgaagcacgaccagacggccaagcaaatggtccaggcgttggtggagctggcgcgg
cgggaccacggtgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggcc
agccaccgccagttcccaggggctgtttatggcacagatggctgtcctgtgtccatcgag
aaaattgtgaacatcttcaatggatccggctgccccagcttgggagggaagcccaagctc
ttctttatccaggcctgtggtggcgagcggaaagaccatggggttgaggtggcctccacg
tcccctgaagacaggacccctggcagtgactccgagccagacgctgtcccgttccaggaa
ggcccagtcacctttgaccagccggacgccgtgtctagcttgcccacacccagtgacatc
tttgtgtcctactccaccttcccaggttttgtttcctggagggacaccaagagcggctcc
tggtacgtggagaccttggatggtgttttcgagcagtgggctcgctctgaggacctgcag
accctcctgctcagggtcgctaatgctgtttcgcagaaagggttttacaagcagattcct
ggttgtttcaatttcctccggaaaaaactttactttaaaatgtaa

DBGET integrated database retrieval system