KEGG   Panthera tigris altaica (Amur tiger): 102967663
Entry
102967663         CDS       T02988                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04390  Hippo signaling pathway
ptg04810  Regulation of actin cytoskeleton
ptg05200  Pathways in cancer
ptg05218  Melanoma
ptg05224  Breast cancer
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102967663 (FGF1)
   04014 Ras signaling pathway
    102967663 (FGF1)
   04015 Rap1 signaling pathway
    102967663 (FGF1)
   04390 Hippo signaling pathway
    102967663 (FGF1)
   04151 PI3K-Akt signaling pathway
    102967663 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102967663 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967663 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102967663 (FGF1)
   05218 Melanoma
    102967663 (FGF1)
   05224 Breast cancer
    102967663 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102967663 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102967663 (FGF1)
Cytokines and growth factors [BR:ptg04052]
 Growth factors
  Growth factors (RTK binding)
   102967663 (FGF1)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102967663 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102967663
NCBI-ProteinID: XP_007078001
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacaaccttcacggccctgacggagaagttcaatctgcctcca
gggaattacaagaaacccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccagatggcacagtggatgggacgagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttgtacggctcacagacaccaaatgaggaatgcttgttc
ctggaaaggctggaagaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aactggtttgtgggtctcaagaagaatggaagctgcaaacgcggtccccggactcactat
ggccagaaggcaattttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system