KEGG   Panthera tigris altaica (Amur tiger): 102967682
Entry
102967682         CDS       T02988                                 

Gene name
IL23A
Definition
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04659  Th17 cell differentiation
ptg05133  Pertussis
ptg05152  Tuberculosis
ptg05200  Pathways in cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102967682 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102967682 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102967682 (IL23A)
   04659 Th17 cell differentiation
    102967682 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967682 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102967682 (IL23A)
   05321 Inflammatory bowel disease
    102967682 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102967682 (IL23A)
   05152 Tuberculosis
    102967682 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102967682 (IL23A)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102967682 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 102967682
NCBI-ProteinID: XP_007081565
LinkDB
Position
Un
AA seq 195 aa
MLGSSRAMLLLLLLLPLLPWTAQTRAVPEGSSPAWALGQQLSQKLCTLAWSAHPPTGHVD
LPREQGDDETTDDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLVFYEKLLGSDIFTGEPS
LLPDSPVGQLHASLLGLRQLLQPDGQHWETEQTPNPSPNQPWQRLLLRFKILRSLQAFVA
VAARVFAHGAATLSP
NT seq 588 nt   +upstreamnt  +downstreamnt
atgctggggagcagcagggctatgctgctgctgctgctcctgctgccactgctgccctgg
actgctcagacccgggctgtgcctgaaggcagtagccctgcctgggctctgggccagcag
ctctcacagaagctctgcacgctggcctggagtgcacatcctccaacgggacatgtggac
ctaccaagagaacagggagatgatgagactacagacgacgtcccccacatccagtgtggg
gatggctgtgatccccaaggactcagagacaacagtcagttctgcttacaaaggatccac
cagggcctggttttttatgagaagctgctgggctcagacattttcacaggggagccctct
ctactccctgatagcccagtgggccagcttcacgcctccctcctgggccttaggcaactc
ttacagcctgacggtcaacactgggagactgagcaaactccaaaccccagtcctaaccag
ccatggcaacgcctccttctccgcttcaagatcctccgcagccttcaggcctttgtggct
gtagctgccagggtctttgcccacggagcagcaaccctgagcccctaa

DBGET integrated database retrieval system