KEGG   Panthera tigris altaica (Amur tiger): 102967826Help
Entry
102967826         CDS       T02988                                 

Gene name
LCK
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04064  NF-kappa B signaling pathway
ptg04380  Osteoclast differentiation
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg05135  Yersinia infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102967826 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102967826 (LCK)
   04660 T cell receptor signaling pathway
    102967826 (LCK)
   04658 Th1 and Th2 cell differentiation
    102967826 (LCK)
   04659 Th17 cell differentiation
    102967826 (LCK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102967826 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102967826 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    102967826 (LCK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102967826 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102967826 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102967826 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptg03036]
    102967826 (LCK)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102967826 (LCK)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  SRC family
   102967826 (LCK)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102967826 (LCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 102967826
NCBI-ProteinID: XP_007092477
LinkDB All DBs
Position
Un
AA seq 509 aa AA seqDB search
MGCSCSSNPEDDWMENIDVCENCHYPIIPLDGKATLPMRNGSDVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDKGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPPGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEERPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtagctgcagctcaaaccctgaagatgactggatggaaaacatcgatgtgtgt
gagaactgccattacccgataatcccactggatggcaaggccacgctgcccatgcggaat
ggctctgatgtgagggatccactagttacctacgaaggctccaatcccccagcctcacca
ttgcaagacaacctggttatcgctctgcacagctacgagccctctcacgatggagacctg
ggcttcgagaagggtgaacagctccgtatcctggagcagagcggcgagtggtggaaggcg
cagtccctgaccacaggccaggaaggtttcatccccttcaacttcgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctgagccgcaaggacgcggaacggcag
ctcctggcgcccgggaacacgcacggctccttcctgatccgggagagcgagagcaccgcg
ggatcgttttcactgtccgtgcgggacttcgaccagaaccagggagaggtggtgaaacat
tacaagatccgtaacctggacaaaggcggcttctacatctccccccgcatcacttttcct
ggcctgcacgagctggtccgccattacaccaatgcttcggacgggctgtgcacgcggttg
agtcgcccctgccagacccagaagccccagaagccttggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtggagcggctgggggctggccagttcggggaggtgtgg
atggggtactacaacgggcacacaaaggtggcagtgaagagcctgaagcagggcagcatg
tcccccgacgccttcctggccgaggccaacctcatgaagcagctacaacaccagaggctg
gtccggctctacgcggtggtcacccaggagcccatctacatcatcacggaatacatggag
aatgggagcctggtggatttcctcaagacccctccaggcatcaagttgaccatcaacaaa
ctcttggacatggcagcccaaattgcagagggcatggcattcattgaagaacggaattac
atccaccgtgacctgagggctgccaacatcctggtgtcggacaccctgagctgcaagatt
gcagactttggcctagcgcgcctcattgaggacaatgagtacacagccagggagggggcc
aagtttcccattaagtggacagcaccagaagccattaactacgggacattcaccatcaag
tcggacgtgtggtcttttgggatcctactgacggagattgtcacccatggccgcatccct
tacccagggatgaccaatcctgaggtgattcagaacctggagcgaggctaccgcatggtg
cgacctgacaactgcccagaggagctataccacctcatgatgctgtgctggaaggagcgg
ccagaggaacggcccacctttgactacctgcgcagcgtgctggaggacttcttcacggcc
acagagggccagtaccagccccagccctga

DBGET integrated database retrieval system