KEGG   Panthera tigris altaica (Amur tiger): 102967956Help
Entry
102967956         CDS       T02988                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01523  Antifolate resistance
ptg04010  MAPK signaling pathway
ptg04014  Ras signaling pathway
ptg04062  Chemokine signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04380  Osteoclast differentiation
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease (American trypanosomiasis)
ptg05145  Toxoplasmosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05212  Pancreatic cancer
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05222  Small cell lung cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05340  Primary immunodeficiency
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102967956 (IKBKG)
   04010 MAPK signaling pathway
    102967956 (IKBKG)
   04064 NF-kappa B signaling pathway
    102967956 (IKBKG)
   04668 TNF signaling pathway
    102967956 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102967956 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102967956 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102967956 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102967956 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102967956 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102967956 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102967956 (IKBKG)
   04660 T cell receptor signaling pathway
    102967956 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102967956 (IKBKG)
   04659 Th17 cell differentiation
    102967956 (IKBKG)
   04657 IL-17 signaling pathway
    102967956 (IKBKG)
   04662 B cell receptor signaling pathway
    102967956 (IKBKG)
   04062 Chemokine signaling pathway
    102967956 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102967956 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102967956 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967956 (IKBKG)
   05203 Viral carcinogenesis
    102967956 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102967956 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102967956 (IKBKG)
   05221 Acute myeloid leukemia
    102967956 (IKBKG)
   05220 Chronic myeloid leukemia
    102967956 (IKBKG)
   05215 Prostate cancer
    102967956 (IKBKG)
   05222 Small cell lung cancer
    102967956 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102967956 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102967956 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102967956 (IKBKG)
   05135 Yersinia infection
    102967956 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102967956 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102967956 (IKBKG)
   05162 Measles
    102967956 (IKBKG)
   05164 Influenza A
    102967956 (IKBKG)
   05161 Hepatitis B
    102967956 (IKBKG)
   05160 Hepatitis C
    102967956 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102967956 (IKBKG)
   05163 Human cytomegalovirus infection
    102967956 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102967956 (IKBKG)
   05169 Epstein-Barr virus infection
    102967956 (IKBKG)
   05165 Human papillomavirus infection
    102967956 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102967956 (IKBKG)
   05142 Chagas disease (American trypanosomiasis)
    102967956 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102967956 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102967956 (IKBKG)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102967956 (IKBKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NEMO Bacillus_HBL Prominin ABC_membrane_2 Exonuc_VII_L RasGAP_C
Motif
Other DBs
NCBI-GeneID: 102967956
NCBI-ProteinID: XP_015399519
LinkDB All DBs
Position
Un
AA seq 173 aa AA seqDB search
MSRPPWKSQLCEMVQPSGGPAGDQDVLGEESSLGKPAMPHLPSEQGTPETFQRCVEENQE
LRDAIRQSNQMLRERCEELQRFQGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRRQREQ
ALQEVEHLKRCQKQLAEDKASVKAQVTSLLGELQESQSRLEAAIKERQALEGR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggcccccctggaagagtcagctgtgtgagatggtgcagcccagcggcggcccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagctatgccccac
ctaccttctgagcagggcactcctgagaccttccaacgctgtgtggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgcttcgggagcgctgtgaggagctgcag
cgtttccaaggcagccagaggaaggagaaggagttcctcatgcagaaattccaggaagcc
aggaaactggtggagagactgagcctggagaagctcgacctgaggaggcagagggagcag
gcccttcaggaggtggaacatctgaagagatgccagaagcagttggctgaggacaaggcg
tcagtgaaagcccaggtgacgtccttgctgggggagctccaagagagccagagtcgcttg
gaggccgccatcaaagagcggcaggctttggagggcaggtga

DBGET integrated database retrieval system