KEGG   Panthera tigris altaica (Amur tiger): 102968123Help
Entry
102968123         CDS       T02988                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04110  Cell cycle
ptg04213  Longevity regulating pathway - multiple species
ptg04330  Notch signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg05016  Huntington's disease
ptg05034  Alcoholism
ptg05165  Human papillomavirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102968123 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102968123 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102968123 (HDAC1)
  Aging
   04213 Longevity regulating pathway - multiple species
    102968123 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102968123 (HDAC1)
   05202 Transcriptional misregulation in cancers
    102968123 (HDAC1)
   05203 Viral carcinogenesis
    102968123 (HDAC1)
   05220 Chronic myeloid leukemia
    102968123 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    102968123 (HDAC1)
  Substance dependence
   05034 Alcoholism
    102968123 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    102968123 (HDAC1)
   05165 Human papillomavirus infection
    102968123 (HDAC1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102968123 (HDAC1)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102968123 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     102968123 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102968123 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    102968123 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102968123
NCBI-ProteinID: XP_007092478
LinkDB All DBs
Position
Un
AA seq 453 aa AA seqDB search
MKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSK
QMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
DLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGD
RLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELP
YNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQVIPEDAI
PEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEK
EKDPEEKKEVTEEEKTKEEKQEAKGVKEEVKLA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctcaccgaatccgcatgactcacaatttgctacttaactatggtctctatcga
aaaatggaaatatatcgccctcacaaggccaatgctgaggagatgaccaagtaccacagt
gacgactacattaaattcttgcgctccatccgcccagataacatgtctgagtacagcaaa
cagatgcagagattcaacgttggtgaggactgtccggtatttgatggcctgtttgagttc
tgtcagttatctactggtggctctgtggcaagtgctgtgaaacttaataagcagcagacg
gacatcgctgtgaattgggctgggggcctgcatcatgcaaagaagtctgaggcatctggc
ttctgttacgtcaatgatatcgtcttggccatcctggaactgctaaagtatcaccagagg
gtgctgtatattgacattgatattcaccacggcgatggcgtggaagaggccttctatacc
acagaccgggtcatgactgtgtcctttcataaatacggagagtacttcccgggaactggg
gacctacgggatattggggctggcaaaggcaagtattacgctgttaactacccgctccga
gatgggatcgatgacgagtcctatgaggccattttcaagccggtcatgtccaaagtaatg
gagatgttccaacccagtgcagttgtcttacagtgtggctctgactccctatctggggat
cggttaggttgcttcaacctgaccatcaaagggcacgccaagtgtgtagagtttgtgaag
agcttcaacctgcctatgctgatgctgggaggaggtggttataccatccgtaacgtggcc
cgctgctggacgtatgaaacagccgtggctctggacacggagatcccaaatgagcttcca
tacaacgactacttcgaatactttggaccagatttcaaacttcacatcagtccttccaat
atgaccaaccagaacaccaatgagtacctggagaagatcaaacagcgactgtttgagaac
ctgcgaatgctgccccacgcacctggggtccaaatgcaggtgattcctgaggatgccatt
ccagaggagagtggcgacgaggacgaagaagaccctgacaagcgcatctcgatctgttcc
tctgacaaacgaatcgcctgtgaggaagagttctcggactctgatgaagagggagaaggc
ggtcgcaagaactcttccaacttcaaaaaagccaagagagtcaaaactgaggatgaaaaa
gagaaagatccagaagagaagaaagaagtcacagaagaggagaaaaccaaggaggagaag
caagaagccaaaggggtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system