KEGG   Panthera tigris altaica (Amur tiger): 102968664
Entry
102968664         CDS       T02988                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03430  Mismatch repair
ptg03460  Fanconi anemia pathway
ptg05200  Pathways in cancer
ptg05210  Colorectal cancer
ptg05213  Endometrial cancer
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102968664 (MLH1)
   03460 Fanconi anemia pathway
    102968664 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102968664 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102968664 (MLH1)
   05226 Gastric cancer
    102968664 (MLH1)
   05213 Endometrial cancer
    102968664 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102968664 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102968664 (MLH1)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     102968664 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 102968664
NCBI-ProteinID: XP_007081090
LinkDB
Position
Un
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKATSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DAKCAYRASYSDGKLTAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGIGFSVKKQGETVADVRTLPSATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGFISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVESKLLGSNSSRMYFTQTLLPGLAGPSGEVV
KSTMGVPPSSTSGSGDKVYAHQMVRTDSREQKLDAFMQPVSKALSGQPQAVVPEDGPEAS
SGRARQQDEEMLELPEPAAVAATNQGLEGDATEGTSQASEKRGPPSSPGNPRKRPRESSD
VEMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPLFIL
RLATEVNWDEEQECFESLSKECAMFYSIRKQYVCEESTLSGQQSDAPGSSANPWKWTVEH
VVYKAFRSHLLPPKRFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggctggacgaaacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccggccaacgccatcaaggagatgattgagaactgctta
gatgcaaaagccaccagcatccaagtggttgttaaagagggaggcctcaagttgattcag
atccaagacaatggcactgggatccggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcgg
ggtgaggctttggccagcatcagccacgtggctcacgttactattacaaccaaaacagct
gatgcaaagtgcgcatacagagcaagttactcagatggaaagctgacagctcctcctaaa
ccatgtgcaggcaatcaggggacccagattacggtagaagatctcttttacaacatatcc
acaaggaggaaagctttaaaaaatccgagtgaagagtatgggaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattggtttctcagttaaaaaacaaggcgagaca
gtggctgacgttagaacactgcccagtgccacaactgtagacaatattcgctccatcttt
ggaaatgctgttagccgagaactgatagaagtcgggtgtgaggataaaaccctagccttc
aaaatgaatggctttatatccaatgcaaattactccgtgaagaagtgtatcttcttactc
ttcatcaaccatcgtctggtagagtcaacttccttaagaaaagccattgaaaccgtgtat
gcagcctatttgcccaaaaacacacacccgttcctgtacctcagtttggagatcagcccc
cagaacgtggatgtcaacgtgcaccccacaaagcacgaggttcacttcctacacgaggac
agcatcctggagcgggtgcaacagcacgttgagagcaagctcctgggctccaactcgtcc
aggatgtacttcacccagactttactcccaggtcttgctggcccctccggggaggtggtg
aagtccacaatgggtgtgcccccctcatccacttctggaagcggcgacaaggtctatgct
caccagatggtccgcacagattcgcgggaacagaagctcgatgcgtttatgcagcctgtg
agcaaggctctgtccggtcagcctcaggccgtggtcccagaagatgggcctgaggcttcc
agcggcagggccaggcagcaggatgaggaaatgctcgaactcccggagcctgctgcagtg
gctgccacaaatcagggcttggagggggatgcaacagaggggacttcacaagcgtcggag
aagagagggcccccttccagcccaggtaaccccagaaagaggccccgggaaagctctgat
gtggaaatggtggaagatgattcccggaaggaaatgacggcggcttgtactccccggaga
aggatcatcaacctcaccagtgtcctgagcctccaggaagaaattaatgagcggggacat
gagactctccgagagatgctgcacaaccactccttcgtgggctgcgtgaatcctcagtgg
gccttggcacagcatcagaccaagctataccttctcaacaccaccaaacttagtgaagaa
ctgttctaccagatactcatttatgattttgccaattttggtgttctgaggctgtcggag
ccagcgccgctctttgacctggccatgctcgccttagacagtcccgagagtggctggaca
gaggaggatggccccaaagaaggacttgctgagtacattgttgagtttctaaagaagaag
gctgagatgcttgcggactatttctccttggagatcgatgaggaagggaacctgattgga
ttacccctgctgatcgacaactacgtgccccctttggagggcctgcctctcttcattctt
cgactagccaccgaggtgaactgggatgaagaacaggaatgttttgaaagcctcagcaaa
gagtgtgctatgttttactccattcggaagcagtatgtatgtgaggagtcgaccctctca
ggccagcagagtgacgcgcccggctcctcagcaaacccctggaagtggactgtggaacac
gtcgtctataaagccttccgctcacaccttctgcctcctaaacgtttcacggaagatgga
aatatcctacagcttgccaacctgcccgatctatacaaagtcttcgagagatgttaa

DBGET integrated database retrieval system