KEGG   Panthera tigris altaica (Amur tiger): 102968706Help
Entry
102968706         CDS       T02988                                 

Gene name
IGLL5
Definition
(RefSeq) Ig lambda-7 chain C region
  KO
K06554  immunoglobulin lambda-like polypeptide 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102968706 (IGLL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102968706 (IGLL5)
CD molecules [BR:ptg04090]
 Proteins
  102968706 (IGLL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 ig C2-set_2 Marek_A I-set PTCRA Pilin
Motif
Other DBs
NCBI-GeneID: 102968706
NCBI-ProteinID: XP_015397603
LinkDB All DBs
Position
Un
AA seq 148 aa AA seqDB search
MQVKALGVRDPPHNVKVQCRGFVFQAVSQCILFGGGTHLTVLGQPKSAPSVTLFPPSSEE
LSANKATLVCLISDFYPSGLTVAWKADGTPVTQGVETTKPSKQSNNKYAASSYLSLSPDQ
WKSRSSYTCQVTHEGSTVEKRVVPAECS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgaaggccctgggtgtcagggaccctcctcacaatgtgaaggtccagtgcaga
gggtttgtgttccaggctgtgtcacagtgtattctgttcggcggagggacccatctgacc
gtcctcggtcagcctaagtcggccccctcagtcacgctcttcccgccctcctctgaggag
ctcagcgccaacaaggccaccctggtgtgcctcatcagtgacttctaccccagcggcttg
acggtagcctggaaggcagatggcacccccgtcacccagggcgtggaaaccaccaagccc
tccaaacagagcaacaacaagtatgcggccagcagctacctgagcctgtcacctgaccag
tggaaatccagaagcagctacacctgccaggtcacgcatgaggggagcaccgtggagaag
agagtggtccctgcagagtgctcttag

DBGET integrated database retrieval system