KEGG   Panthera tigris altaica (Amur tiger): 102968736
Entry
102968736         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 4A11-like
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00071  Fatty acid degradation
ptg00590  Arachidonic acid metabolism
ptg00830  Retinol metabolism
ptg01100  Metabolic pathways
ptg03320  PPAR signaling pathway
ptg04270  Vascular smooth muscle contraction
ptg04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102968736
   00590 Arachidonic acid metabolism
    102968736
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102968736
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102968736
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102968736
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102968736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102968736
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     102968736
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP4 family
   102968736
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102968736
NCBI-ProteinID: XP_007077306
LinkDB
Position
Un
AA seq 510 aa
MSVSVLSLTRPLGSVSGLLQVASLLGLALLLLKAAQLYLRRQWLLKAVQHFPSPPSHWLF
GDIQEFQDGQELQKLQKRAEKYPCASPRWLWGSKVILIVYDPDYMKVILGRSDPKSHGIS
RFLAPWIGYGLLLLNGQMWFQHRRMLTPAFHYGILKPYVRLIDDSVRVMLDKWEDLIRQN
ANVEIFEHVSLMTLDTIMKCAFSYQGSHEADRISQSYIQAIQDLSNLAFSRVRNVFHQDD
IIYRLTPEGRWNHRACQIAHQHTDRVIKLRKAQLQEEGALEKVRSKRHLDFLDILLFARM
EDGSRLTDKDLRAEVDTFMFEGHDTTASGISWILYALATHPEHQQRCRKEVQSLLGDGTS
ITWDHLDQMPYTTMCIKEALRLYPPVPGISRDLSKPITFPDGRSLPKGFTVFLSIYALHH
NPKVWPNPEVFDPLRFAPGSARHSHAFLPFSGGARNCIGKQFAMNEMKVAVALTLLRFEL
APDPSRIPVPWPRIVLKSKNGIHLHLRKLL
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgagtgtctctgtgctgagcctcaccagacccttgggcagtgtctccggactcctgcaa
gtggcctctctgctaggcctggctctgctgttgctcaaggcagcacagctctacctgcgc
aggcagtggctgctcaaagcagtccagcacttcccgtcccctccttcccactggctcttc
ggggacatccaggagttccaagatggccaagagctacaaaagcttcagaaaagggcagag
aaatacccatgtgccagtcctcgctggctgtgggggagcaaagttatcctcatagtctat
gatccggattacatgaaggtgatcctggggcgatcagacccaaagtctcatggcatctcc
agattcctggctccgtggatagggtatggtttgctcctgttgaatggtcagatgtggttc
caacaccggcggatgctgaccccagccttccactatggcatcctgaagccctacgtgagg
ctcatagatgattctgtccgcgtgatgctggacaaatgggaggacctcatcagacagaac
gcaaatgtggagatctttgagcatgtctccttgatgaccttagacaccattatgaagtgc
gccttcagctaccaaggcagccacgaagcagacaggatctcccagtcctacatccaggcc
attcaagacctgagcaacctggctttttcccgagtgaggaatgttttccaccaggatgac
atcatttataggctgacccctgaaggccgctggaaccaccgggcctgccagattgcccat
caacatacagaccgagtgatcaagctgaggaaggctcagctgcaggaggagggagctctg
gagaaggtcaggagcaagaggcacttggacttcctggacatcctcctctttgccagaatg
gaggacggcagcagattgactgacaaggacctccgtgccgaagtggatacgttcatgttt
gagggccatgacaccacagccagtggcatctcctggatcctctatgccctggccacacac
cctgagcatcagcagaggtgccggaaggaggtccagagtctcctgggggatggtacctcc
atcacctgggaccacctagaccagatgccttacaccaccatgtgcattaaagaggcactg
cgactctacccaccagttccaggcatcagcagagatctcagcaagcccatcactttccct
gatggacgctccttacccaaaggattcacagtgttcctctccatttatgcccttcaccac
aacccaaaggtgtggccaaacccagaggtgtttgaccctttgcggtttgcaccaggttct
gcccgacacagccatgctttcttgcccttctcaggaggagcaaggaattgcatcgggaag
cagtttgccatgaacgagatgaaggtggcggtggccctgaccctgctccgctttgagctg
gcaccagatccttccaggatccctgttccctggccaagaattgtgttgaagtccaagaat
gggatccacctgcatctcaggaagctcctctaa

DBGET integrated database retrieval system