KEGG   Panthera tigris altaica (Amur tiger): 102968780
Entry
102968780         CDS       T02988                                 

Gene name
IL6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01523  Antifolate resistance
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04218  Cellular senescence
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04657  IL-17 signaling pathway
ptg04659  Th17 cell differentiation
ptg04668  TNF signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg04931  Insulin resistance
ptg04932  Non-alcoholic fatty liver disease
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05010  Alzheimer disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05321  Inflammatory bowel disease
ptg05323  Rheumatoid arthritis
ptg05332  Graft-versus-host disease
ptg05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102968780 (IL6)
   04668 TNF signaling pathway
    102968780 (IL6)
   04066 HIF-1 signaling pathway
    102968780 (IL6)
   04068 FoxO signaling pathway
    102968780 (IL6)
   04151 PI3K-Akt signaling pathway
    102968780 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102968780 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102968780 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102968780 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102968780 (IL6)
   04620 Toll-like receptor signaling pathway
    102968780 (IL6)
   04621 NOD-like receptor signaling pathway
    102968780 (IL6)
   04623 Cytosolic DNA-sensing pathway
    102968780 (IL6)
   04625 C-type lectin receptor signaling pathway
    102968780 (IL6)
   04659 Th17 cell differentiation
    102968780 (IL6)
   04657 IL-17 signaling pathway
    102968780 (IL6)
   04672 Intestinal immune network for IgA production
    102968780 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102968780 (IL6)
   05202 Transcriptional misregulation in cancer
    102968780 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102968780 (IL6)
   05321 Inflammatory bowel disease
    102968780 (IL6)
   05332 Graft-versus-host disease
    102968780 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102968780 (IL6)
   05020 Prion disease
    102968780 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    102968780 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102968780 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102968780 (IL6)
   04931 Insulin resistance
    102968780 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102968780 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102968780 (IL6)
   05135 Yersinia infection
    102968780 (IL6)
   05133 Pertussis
    102968780 (IL6)
   05134 Legionellosis
    102968780 (IL6)
   05152 Tuberculosis
    102968780 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102968780 (IL6)
   05161 Hepatitis B
    102968780 (IL6)
   05171 Coronavirus disease - COVID-19
    102968780 (IL6)
   05164 Influenza A
    102968780 (IL6)
   05162 Measles
    102968780 (IL6)
   05168 Herpes simplex virus 1 infection
    102968780 (IL6)
   05163 Human cytomegalovirus infection
    102968780 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102968780 (IL6)
   05169 Epstein-Barr virus infection
    102968780 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102968780 (IL6)
   05144 Malaria
    102968780 (IL6)
   05142 Chagas disease
    102968780 (IL6)
   05143 African trypanosomiasis
    102968780 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102968780 (IL6)
   01523 Antifolate resistance
    102968780 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102968780 (IL6)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102968780 (IL6)
SSDB
Motif
Pfam: IL6 GCSF DUF4924 IL11 IL23 Sec16
Other DBs
NCBI-GeneID: 102968780
NCBI-ProteinID: XP_007089129
LinkDB
Position
Un
AA seq 233 aa
MSKRNERELHLPSRTPAMTFLSTSAFSPLAFSLGLLLVVANAFPSPGPLGGATPGPLGGD
DTSNRLPLTSADKMEELIKYILGKISALKKEMCDNYNKCEDSKEALAENNLNLPKLAEKD
GCFQSGFNQETCLTRITTGLQEFQIYLKFLQDKYEGDKENAKSVYTNTNVLLQMLKRKGK
NQDEVTIPVPTVEVGLQAKLQSQEEWLRHTTIHLTLRRLEDFLQFSLRAVRIM
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtcaaagaggaacgaaagagagctccatctgccctccaggactccagccatgaccttc
ctctccacaagcgccttcagtccactcgccttctccctggggctgctcctggtggtggct
aacgctttcccttccccgggccccctgggaggagctaccccgggacccctgggaggagat
gacacctcaaatagactaccactgacctctgcagacaaaatggaagaactcattaagtac
atcctcggcaaaatctctgcactgaaaaaggagatgtgtgacaactataacaaatgtgag
gacagcaaggaggcactggcagaaaacaacctaaatcttccgaaactggcagaaaaagat
ggatgcttccaatctgggttcaatcaggagacctgcctgacaagaatcactactggtctt
caggagtttcagatatacctgaaattcctccaggacaagtatgagggtgataaggaaaat
gccaagtctgtatacaccaatactaacgtcctgctccagatgctgaagcgtaagggaaag
aatcaggatgaggtaaccatccctgtcccaaccgtagaagttggcctgcaggctaagctg
cagtcacaggaagagtggctgaggcacacaacaattcacctcaccctgcgaaggctggag
gacttccttcagttcagcctcagggctgttcggataatgtaa

DBGET integrated database retrieval system