KEGG   Panthera tigris altaica (Amur tiger): 102968822
Entry
102968822         CDS       T02988                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg04012  ErbB signaling pathway
ptg04015  Rap1 signaling pathway
ptg04062  Chemokine signaling pathway
ptg04137  Mitophagy - animal
ptg04144  Endocytosis
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04510  Focal adhesion
ptg04520  Adherens junction
ptg04530  Tight junction
ptg04540  Gap junction
ptg04611  Platelet activation
ptg04625  C-type lectin receptor signaling pathway
ptg04727  GABAergic synapse
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg04912  GnRH signaling pathway
ptg04915  Estrogen signaling pathway
ptg04917  Prolactin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04926  Relaxin signaling pathway
ptg05100  Bacterial invasion of epithelial cells
ptg05135  Yersinia infection
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05219  Bladder cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102968822 (SRC)
   04015 Rap1 signaling pathway
    102968822 (SRC)
   04370 VEGF signaling pathway
    102968822 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102968822 (SRC)
   04137 Mitophagy - animal
    102968822 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102968822 (SRC)
   04520 Adherens junction
    102968822 (SRC)
   04530 Tight junction
    102968822 (SRC)
   04540 Gap junction
    102968822 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102968822 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102968822 (SRC)
   04625 C-type lectin receptor signaling pathway
    102968822 (SRC)
   04062 Chemokine signaling pathway
    102968822 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102968822 (SRC)
   04915 Estrogen signaling pathway
    102968822 (SRC)
   04917 Prolactin signaling pathway
    102968822 (SRC)
   04921 Oxytocin signaling pathway
    102968822 (SRC)
   04926 Relaxin signaling pathway
    102968822 (SRC)
   04919 Thyroid hormone signaling pathway
    102968822 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    102968822 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102968822 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    102968822 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102968822 (SRC)
   05203 Viral carcinogenesis
    102968822 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    102968822 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102968822 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102968822 (SRC)
   05152 Tuberculosis
    102968822 (SRC)
   05100 Bacterial invasion of epithelial cells
    102968822 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102968822 (SRC)
   05168 Herpes simplex virus 1 infection
    102968822 (SRC)
   05163 Human cytomegalovirus infection
    102968822 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102968822 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102968822 (SRC)
   01522 Endocrine resistance
    102968822 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102968822 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102968822 (SRC)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102968822 (SRC)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  SRC family
   102968822 (SRC)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102968822 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102968822 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102968822 (SRC)
  Macropinocytosis
   Kinases
    102968822 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 102968822
NCBI-ProteinID: XP_007077761
LinkDB
Position
Un
AA seq 536 aa
MGSNKSKPKDASQRRRSLEPAENTHGGGGGAFPTSQTPSKPASADGHRGPSTAFPSAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgctagccaacggcgccgcagcctggagcct
gctgagaacacccacggtggtggtgggggtgccttccccacctcacagacacccagcaag
ccagcctccgctgatggccaccgaggccccagtacggccttcccctctgccgctgctgag
cccaagctgttcgggggcttcaactcctcggacacagtcacctccccgcagagggcgggg
ccactggcgggtggagtgaccacctttgtggccctctatgactatgagtctcggacagag
actgacctgtccttcaagaaaggggagcggctccagattgtcaacaacacagagggtgac
tggtggctggcccactcactcagcacaggacagacgggctacatccccagcaactatgtg
gcgccctctgactctatccaggccgaagagtggtactttggcaagatcaccagacgggag
tcagagaggttactgctcaatgcggaaaacccaagagggaccttcctagtgcgagaaagc
gagaccacgaaaggcgcctactgcctctccgtgtccgatttcgacaacgccaagggcctc
aatgtgaagcattacaagatccgcaagctggacagcggtggcttctacatcacctcccgc
acccagttcaacagtctgcagcagctggtggcctactactccaaacatgccgacggcctc
tgccaccgcctcaccaccgtgtgccccacgtccaagccacagactcagggtctggccaaa
gatgcctgggagatcccccgggagtccctgcggctggaggtcaagctgggccagggctgt
ttcggagaggtgtggatggggacctggaatggaaccaccagggtggccatcaaaaccctg
aagccaggcacaatgtctccagaggcctttctgcaggaggcccaggtcatgaagaaacta
aggcacgagaaattggtgcagctgtatgccgtggtgtctgaggagcccatctacattgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgccacagctggtggacatggctgctcagatcgcctcgggcatggcctacgtg
gagcggatgaactacgtgcaccgggacctccgtgctgccaacattctggttggagagaac
ctcgtgtgcaaagtggccgacttcgggctggctcggctcatcgaagacaatgaatacacc
gcccggcaaggtgccaaattccccatcaagtggacggctccagaagcggccctgtacggc
cggttcaccatcaagtcagatgtgtggtcctttgggatcctgctgacggagctcacaaca
aagggacgggtgccctaccctgggatggtcaaccgtgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgcctgagtgtcccgagtccctgcatgacctcatgtgccag
tgctggcggaaggaaccagaagagcggcccaccttcgagtacctgcaggccttcctagag
gactacttcacgtccaccgagccccagtaccagcctggagagaacctatag

DBGET integrated database retrieval system