KEGG   Panthera tigris altaica (Amur tiger): 102969006
Entry
102969006         CDS       T02988                                 

Gene name
GSS
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00270  Cysteine and methionine metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04216  Ferroptosis
Module
ptg_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    102969006 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102969006 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102969006 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102969006 (GSS)
Enzymes [BR:ptg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     102969006 (GSS)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102969006 (GSS)
SSDB
Motif
Pfam: GSH_synth_ATP GSH_synthase
Other DBs
NCBI-GeneID: 102969006
NCBI-ProteinID: XP_007073675
LinkDB
Position
Un
AA seq 474 aa
MATGWGSLLQDEQQLEELARQAVDRALAEGVLLRTLQEPSSSDVVSYAPFALFPSLVPSA
LLEQAYAVQMDFNMLVDAVSQNAAFLEQTLSSTIKRDNFTARLFNIYKQVLKEGIAQVTX
XXXNRSDYMFQRNADGSPVLKQIEINTISASFGGLASRTPAVHRHVLNVLSKTKEAAKIL
SNNPSKGLAQGITKAWELYGSANALVLLIAQEKERNIFDQRAIENELLAKNIHVIRRRFE
DVFEKGSLDQDRRLFMDGQEVAVVYFRDGYMPSQYSVQNWEARLLLERSCAIKCPDIATQ
LAGTKKVQQELSRMGVLEMLLPGQPETVARLRATFAGLYSLDMGEEGDQAITEALASPSQ
FVLKPQREGGGNNLYGEEMVQALEHLKDSEERASYILMEKIEPEPFGNCLLRPGSPVRVV
QCISELGIFGVYVRQGKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggccaccggctgggggagcctcttgcaggatgagcagcagctggaggagctggcacgg
caggctgtggaccgggccctggctgagggagtgctgctgaggaccttgcaggagcccagt
tcctccgatgtggtaagctatgccccattcgcgctcttcccttcactggtccccagtgcc
ctgctggagcaggcctatgctgtgcagatggactttaacatgctggtggatgctgtcagc
cagaatgcagcctttctggagcagactctctccagcaccatcaaaagggacaacttcact
gctcgcctctttaacatctacaagcaagtcctaaaagaaggcattgctcaggtaacnnnn
nnnnnnnngaaccgctcagactacatgttccagcgcaatgcagatggctccccagtcctg
aaacagattgaaatcaacaccatctctgccagctttgggggcctggcctcccgtacccca
gctgtgcaccgacatgttctcaatgtcctgagtaagaccaaagaagctgccaagatcctc
tccaataatcccagcaagggactggcccaggggatcaccaaggcctgggagctctacggc
tcagccaacgctctggtgctactgattgctcaagagaaggaaaggaacatatttgaccag
cgtgctatagagaatgagctactagccaagaatatccacgtaatccgtcgaaggtttgaa
gatgtctttgaaaaggggtctctagaccaagaccgaaggctgtttatggatggccaggaa
gttgctgtggtttatttccgggatggctacatgccgagtcagtacagtgtacagaactgg
gaagcacgcctgctgctggagaggtcatgtgctattaagtgcccagatattgccacccag
ctggctgggacaaagaaggtgcagcaggagctgagcagaatgggtgtgctggagatgttg
ctccctggccagcctgagactgtggcccgcctccgtgccacatttgctggcctctactca
ctggacatgggtgaagaaggggaccaggccattactgaggcccttgcttcccctagccag
ttcgtgctaaagccccagagagagggtggaggtaataacctatatggggaggagatggtg
caggccctggagcacctgaaagacagcgaggagagggcgtcctacatcctcatggagaag
atagaacctgagccttttggaaattgtctgctacggcctggcagccctgtccgagtggtc
cagtgcatctcagagctgggcatctttggagtctatgtcaggcagggaaagacacttgtg
atgaacaagcatgtgggacatctgcttcgaaccaaagccattgagcatgcagatggtgga
gtggcagcaggagtggcagtcctggacaacccgtaccctgtgtga

DBGET integrated database retrieval system