KEGG   Panthera tigris altaica (Amur tiger): 102969051
Entry
102969051         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 2E1
  KO
K07415  cytochrome P450 family 2 subfamily E1 [EC:1.14.14.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00590  Arachidonic acid metabolism
ptg00591  Linoleic acid metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg04932  Non-alcoholic fatty liver disease
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102969051
   00590 Arachidonic acid metabolism
    102969051
   00591 Linoleic acid metabolism
    102969051
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102969051
   00982 Drug metabolism - cytochrome P450
    102969051
   00983 Drug metabolism - other enzymes
    102969051
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102969051
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102969051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ptg00199]
    102969051
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     102969051
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP2 family
   102969051
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102969051
NCBI-ProteinID: XP_007079775
LinkDB
Position
Un
AA seq 495 aa
MAALGITVALLVWMATLMLISVWKQIYSSWKLPPGPFPLPIIGNLLQLDFKNVPKSLTKL
AERYGPVFTLYLGSQRTVVLHGYKAVKEVLLDYKNEFSGRGEIYAFAAHKEKGITFNNGP
SWKDTRRLSLSILRDYGMGKLANEERIQREVPFLTEAFRKTQGQPFDPTFVLGYAPCNVI
SDILFHKRFDYTDQTGLRIQKLFNENFHLLSTSWLQLYNIFPSYMRYLPGNHRKVIKNVY
EIKSYTAARVKEHEESLDPNCPRDFTDSLLLEMRKERYTKEPWFTFDNIAATIADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRLEMPYMDAVVHEIQRF
IDLLPSNLPHEAIQDTMFRGYVIPKGTVVVPTLDSLLFDNQEFPDPEKFMPEHFLNESGK
FKYSDYFKVFSAGKRVCVGEGLARMELFLFLSAILQHFNLKPLVDPKDIDLSPSTIGFAK
IPPRYKLCVIPRSGV
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggctgccctgggcatcacagttgccctgttggtgtggatggccaccctaatgcttatc
tctgtctggaagcagatctacagcagctggaaactaccccctggccctttcccactgccc
attattgggaatcttctccagttggatttcaagaatgttcccaaatctttaaccaagttg
gcagagcggtacgggcctgtgttcaccttgtacctgggctcccagcgcaccgtggttctg
catggctataaggcagtgaaggaagtcctgctcgactacaagaatgaattttctggcaga
ggagaaatctatgcctttgcggcacacaaggaaaaaggaattacgttcaacaatgggccg
agctggaaggacacccggcgcctgtctctgagcatcctccgggactatggcatggggaag
cttgccaatgaggagcggatccagagggaggtgcccttcctgacggaggcattccggaag
acccagggacagcccttcgaccccacctttgttctgggctacgccccctgcaacgtcatc
tcggacatcctcttccacaagcgctttgactacacggaccaaaccgggctgaggatacag
aagctgttcaacgagaacttccacctgctcagcaccagctggctccaattatataacatt
ttcccaagctatatgcgctacctgcctggaaaccatagaaaagtaataaaaaatgtgtat
gaaataaaaagttatactgcagcaagagtgaaggagcacgaggagtcgctggaccccaac
tgcccccgggacttcactgacagcctgctcctggagatgcggaaggaaagatacaccaaa
gagccttggttcacctttgacaacattgctgccaccatagctgacctgttttttgcgggt
acagagaccaccagcaccactctgagatatgggctcctgattctcatgaaatacccagag
atcgaagagaaactgcatgaagaaatcgacagggtgattgggccaagccgaatccctgcc
atcaaggaccggttagagatgccttatatggatgccgtggtgcatgagattcagcgattc
atcgacctcttgccctccaacctgccccatgaagcaatccaggacacaatgttcagagga
tacgtcatccccaagggtacagtcgtggtcccaacgctggactccctcttgtttgacaac
caagagttccctgatccagagaagtttatgccagagcactttctgaatgaaagtggaaag
ttcaaatatagtgattatttcaaggtattttctgcaggaaagcgggtgtgtgttggagaa
ggcctggctcgcatggagttgttcctgttcttgtccgccattttgcagcactttaacctg
aagcctctcgttgaccccaaggatatcgatctcagtcccagcacaattgggtttgccaaa
atcccaccccgttacaagctctgtgtcattccccgttcgggtgtgtga

DBGET integrated database retrieval system