KEGG   Panthera tigris altaica (Amur tiger): 102969057Help
Entry
102969057         CDS       T02988                                 

Gene name
CD3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04640  Hematopoietic cell lineage
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg05142  Chagas disease (American trypanosomiasis)
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102969057 (CD3D)
   04660 T cell receptor signaling pathway
    102969057 (CD3D)
   04658 Th1 and Th2 cell differentiation
    102969057 (CD3D)
   04659 Th17 cell differentiation
    102969057 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102969057 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    102969057 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102969057 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    102969057 (CD3D)
   05162 Measles
    102969057 (CD3D)
   05169 Epstein-Barr virus infection
    102969057 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102969057 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ptg04090]
    102969057 (CD3D)
CD molecules [BR:ptg04090]
 Proteins
  102969057 (CD3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_4 ITAM Ig_5
Motif
Other DBs
NCBI-GeneID: 102969057
NCBI-ProteinID: XP_007080452
LinkDB All DBs
Position
Un
AA seq 170 aa AA seqDB search
MEHSSFLAGLTLSVLLSQVSPYKISVEELEDKVLLSCNTSIIWMEGTMGTLFRNDTNLDL
GKRILDPRGVYTCKRPDEQDKIPYTQVYYRMCQNCVELDSGTLAGIIITDIFATLLLALG
VYCFAGHETGRLSKAADTQALLGNDQSYQPLRDRNDAQYSHLGENWPRKK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggaacactccagttttctggctggcctgacactgtctgtccttctctcccaagtgagt
ccctacaagatatccgtggaggaactggaggacaaggtgttgctgagttgtaacactagc
atcatatggatggagggaacgatgggaacgctatttcgcaacgatacaaatctggacctg
ggaaaacgcatcctggacccacgaggagtgtatacgtgcaagaggccagacgaacaagac
aagataccttacacgcaagtatattatcgaatgtgtcagaactgtgtggaactggactca
ggcaccctggccggcatcatcatcacggacatattcgccactcttctcctcgctttgggg
gtctattgctttgcgggacatgagaccggaaggctctctaaggccgctgacactcaagct
ctcctgggaaatgaccagagctatcagcccctgcgagatcggaatgatgctcagtacagt
catcttggtgaaaactggcctcggaagaagtga

DBGET integrated database retrieval system