KEGG   Panthera tigris altaica (Amur tiger): 102969244Help
Entry
102969244         CDS       T02988                                 

Gene name
ZAP70
Definition
(RefSeq) tyrosine-protein kinase ZAP-70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04014  Ras signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg05135  Yersinia infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102969244 (ZAP70)
   04064 NF-kappa B signaling pathway
    102969244 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102969244 (ZAP70)
   04660 T cell receptor signaling pathway
    102969244 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    102969244 (ZAP70)
   04659 Th17 cell differentiation
    102969244 (ZAP70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102969244 (ZAP70)
  09163 Immune disease
   05340 Primary immunodeficiency
    102969244 (ZAP70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102969244 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102969244 (ZAP70)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102969244 (ZAP70)
Protein kinases [BR:ptg01001]
 Non-receptor tyrosine kinases
  SYK family
   102969244 (ZAP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 102969244
NCBI-ProteinID: XP_007097879
LinkDB All DBs
Position
Un
AA seq 459 aa AA seqDB search
MPWYHSSLTREEAERKLYSGSQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGK
YCIPEGTKFDTLWQLVEYLKLKADGLIYCLKDACPNSSASASSEAAAPTLPAPPSTFTHA
QRRIDTLNSDGYTPEPARLVSTEKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLIA
DIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKHSTEKTDKDEMMREAQIMHQLDNPYIVR
LIGVCQAEALMLVMEMAGGGPLHKFLLGKKEEIPISNVAELLHQVSMGMKYLEEKNFVHR
DLAARNVLLVNRHYAKISDFGLSKALGADDSYYTARSAGKWPLKWYAPECFNFRKFSSRS
DVWSYGVTMWEAFSYGQKPYKKMKGPEVIAFIEQGKRMECPPDCPPEMYTLMSDCWIYKW
EDRPDFLAVEQRMRTYYYSLASKTEDPPGPGKGTETAFA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccctggtaccacagcagcctgactcgagaggaggcggagcgcaaactctattcgggc
tcgcagaccgacggcaagttcctgctgaggccccggaaggagcagggcacgtacgcactg
tccctgatctacgggaaaaccgtataccactacctcatcagccaggacaaggcaggcaaa
tactgtattcctgaggggaccaagtttgacacgctctggcagctggtagagtacctgaag
ctgaaggctgatgggctcatctactgcctgaaggatgcctgccccaactccagcgccagc
gccagctcagaggctgctgctcccacactcccagctcccccatccactttcacccatgct
cagagacggattgatacccttaactcagatggatacacccctgaaccagcacgcctagtg
tccacagagaagccaaggccaatgcccatggacacaagtgtgtacgagagcccctacagt
gaccctgaggagctcaaggacaagaagctcttcctgaagcgtgagaacctcctcatcgct
gatatagaacttggctgtggcaactttggctcagtgcgccagggcgtctatcgcatgcgc
aagaagcagattgacgtcgccatcaaggtgttgaagcacagcacggagaagacagacaag
gatgagatgatgcgcgaggcgcagattatgcaccagctggacaacccctacatcgtgcgg
ctcatcggcgtctgccaggccgaggccctcatgctcgtcatggagatggccggcggcggg
cccctgcacaagttcctgcttgggaagaaggaggagatccccatcagcaacgtggcggag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaaaaattttgtgcaccgt
gacctggcagcccgcaacgtcctgctggtcaaccggcactacgccaagatcagcgacttc
ggtctctccaaggcactgggtgccgacgacagctactatactgcccgctcggcagggaag
tggccgctcaagtggtatgcgcccgagtgtttcaacttccgcaagttctccagccgcagt
gatgtttggagctatggggtcaccatgtgggaggccttctcctatggccagaagccctac
aagaagatgaagggccctgaagtcatagccttcatcgagcagggcaagaggatggagtgc
ccgccagactgtccacctgaaatgtacacactcatgagtgactgctggatctacaagtgg
gaagaccgcccagacttcctggctgtggagcagcgcatgcggacctactattacagcttg
gcgagcaagactgaggaccccccggggcctggaaagggaaccgagactgcttttgcctga

DBGET integrated database retrieval system