KEGG   Panthera tigris altaica (Amur tiger): 102969350Help
Entry
102969350         CDS       T02988                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04064  NF-kappa B signaling pathway
ptg04514  Cell adhesion molecules (CAMs)
ptg04660  T cell receptor signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05322  Systemic lupus erythematosus
ptg05330  Allograft rejection
ptg05340  Primary immunodeficiency
ptg05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    102969350 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102969350 (CD40LG)
   04514 Cell adhesion molecules (CAMs)
    102969350 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102969350 (CD40LG)
   04672 Intestinal immune network for IgA production
    102969350 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102969350 (CD40LG)
   05322 Systemic lupus erythematosus
    102969350 (CD40LG)
   05320 Autoimmune thyroid disease
    102969350 (CD40LG)
   05330 Allograft rejection
    102969350 (CD40LG)
   05340 Primary immunodeficiency
    102969350 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102969350 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    102969350 (CD40LG)
   05145 Toxoplasmosis
    102969350 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102969350 (CD40LG)
   04090 CD molecules [BR:ptg04090]
    102969350 (CD40LG)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Tumor necrosis fators
   102969350 (CD40LG)
CD molecules [BR:ptg04090]
 Proteins
  102969350 (CD40LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 102969350
NCBI-ProteinID: XP_007098546
LinkDB All DBs
Position
Un
AA seq 260 aa AA seqDB search
MIETYSQTAPRSVAPGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLY
EDFVFMKTLQKCNKGEGALSLLNCEEIKSRFEAFLKDIMLNKEMKKEKNVAMQKGDQDPR
VAAHVISEASSSTASVLQWAPKGYYTISSNLVTLENGKQLAVKRQGLYYIYAQVTFCSNR
EASSQAPFIASLCLHSPSGSERVLLRAANARSSSKPCGQQSIHLGGVFELHPGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacatatagccaaactgctccccgctccgtggcccctggaccacccgtcagt
atgaaaatttttatgtatttacttactgtgtttctcatcacccagatgattgggtcagca
ctctttgctgtgtatcttcacagaagactggacaagatagaagacgaaaggaatctttat
gaagattttgtgttcatgaaaacattacagaaatgcaacaaaggagagggggccttatcc
ttactgaactgtgaggaaattaaaagccggtttgaagcctttctcaaggacataatgcta
aacaaagaaatgaagaaagaaaaaaatgttgcaatgcaaaaaggcgatcaggatcctcga
gttgccgcacatgtcataagtgaggccagcagtagcacagcgtccgttctccagtgggcc
cccaaaggctactacaccataagcagcaacttggtaaccctcgagaatgggaagcagctg
gccgtcaaaagacaaggactctattatatctacgcccaagtcaccttctgttccaatcgg
gaagcttcgagtcaagctccgtttatagccagcctctgcctgcattccccgagtggatcc
gagagagtcttactcagagctgcaaatgcccgcagttcctccaaaccctgtgggcagcaa
tccattcacttgggaggagtcttcgaactgcatccgggggcttcggtgttcgtgaacgtg
actgatccgagccaagtgagccacgggacgggcttcacgtcttttggcttgctcaaactc
tga

DBGET integrated database retrieval system