KEGG   Panthera tigris altaica (Amur tiger): 102969787Help
Entry
102969787         CDS       T02988                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00010  Glycolysis / Gluconeogenesis
ptg00030  Pentose phosphate pathway
ptg00051  Fructose and mannose metabolism
ptg00052  Galactose metabolism
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg01230  Biosynthesis of amino acids
ptg03018  RNA degradation
ptg04152  AMPK signaling pathway
ptg05230  Central carbon metabolism in cancer
Module
ptg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102969787 (PFKM)
   00030 Pentose phosphate pathway
    102969787 (PFKM)
   00051 Fructose and mannose metabolism
    102969787 (PFKM)
   00052 Galactose metabolism
    102969787 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102969787 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102969787 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102969787 (PFKM)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102969787 (PFKM)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102969787 (PFKM)
Messenger RNA biogenesis [BR:ptg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102969787 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 102969787
NCBI-ProteinID: XP_007073009
LinkDB All DBs
Position
Un
AA seq 782 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKTGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQMTKDVTK
AMNDRKFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKGPSSIHTVAVMNVGAPAAGMNAA
VRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSF
EQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLFDELCIPFVVIPATVSNNVPGSDF
SVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEE
PFTIRDLQANVEHLVHKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNV
LGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRAL
VFQPVTELKEQTDFDHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEA
SI
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccaaaaccctggggattggcaaagccatcgccgtg
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatctttactggtgcccgtgtgttctttgtccatgagggttatcaaggcctggtggat
ggtggagataacatcagggaagccacctgggagagtgtttcgatgatgcttcagctggga
ggcacagtcattggaagtgcccggtgcaaggacttccgtgaacgagagggacgactccgc
gctgcccacaacctggtgaagcgtgggattactaatctgtgtgtcatcgggggtgatggc
agcctcactggggctgacaccttccgttctgagtggagtgacttactgagtgacctccag
aaagcgggtaagatcacagcggaggaggctacgaagtccagctatctgaatatcgtgggt
ttggtgggctcaattgacaatgacttttgtggcactgatatgaccattggcactgattcc
gccctgcaccggatcatagagattgtggacgccatcaccaccactgctcagagccaccag
aggacgtttgtgctagaagtgatgggccggcactgtggatacctggcccttgtcacctct
ctctcctgtggggctgactgggtttttattcctgagtgtccaccggatgacgactgggaa
gaacatctttgtcgccggctcagcgagacaaggacccgtggttctcgtctcaacatcatc
attgtggctgagggtgccatcgacaagactgggaaacccataacctcagaagacatcaag
aatctggtggtgaagcgtctgggatatgacacccgggtcactgtcttggggcatgtgcag
cggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaggca
gtgatggcacttttggaagggactccagacaccccagcctgtgtggtgagcctctctggg
aaccaggctgtgcgcctgcccctcatggagtgtgtccaaatgaccaaagatgtgaccaag
gccatgaacgacaggaaatttgatgaagccatgaagctgagaggccggagcttcatgaac
aactgggaagtgtacaagcttctggctcatgtcagacccccagtctctaagggaccgagt
agcatacacacagtggccgtgatgaacgtgggggccccagccgcaggcatgaacgctgcc
gtccgttccaccgtgaggattggcctcatccagggcaaccgggtgctggttgtacatgat
ggcttcgagggcctggccaagggtcagatcgaggaagctggctggagctatgttgggggc
tggactggccaaggtggttccaaacttgggactaaaaggactctacccaagaagagcttt
gagcagatcagtgccaacatcactaagtttaacattcagggccttgtcatcattgggggc
tttgaggcttacacagggggcctggaactgatggagggcaggaagctgtttgacgagctg
tgcatcccgtttgtggtcatccccgcgacggtctccaacaacgtccccggctcggacttc
agcgtgggggctgacacagcactcaatactatctgcacgacctgtgaccgcatcaagcag
tcagcggcaggcaccaagcgtcgggtgtttatcatcgaaacgatgggtggctactgtggc
tacctggccaccatggcaggactggcagctggggccgatgctgcctacatttttgaggag
cccttcaccattcgggacctgcaggcaaatgttgaacatctggtgcataagatgaaaacc
actgtgaaaaggggcttggtgttaaggaatgagaagtgcaatgagaactataccacggac
ttcatcttcaacctgtactctgaggaggggaagggcatatttgacagcaggaagaatgtg
cttgggcacatgcagcagggtggaagcccaactccgtttgacaggaattttgccactaag
atgggtgccaaggctatgaactggatgtctgggaaaatcaaagagagttaccgtaatggg
aggatcttcgccaatacaccagactcaggctgtgttctggggatgcgtaagagggctctg
gtctttcaaccggtgactgagctgaaggagcagacggattttgaccaccgcatccccaag
gagcagtggtggctgaagctgaggcccatcctcaaaatcctagccaagtatgagattgac
ttggacacctcagagcacgcccacctggagcacatcagccggaagcgatctggagaagct
tctatctaa

DBGET integrated database retrieval system