KEGG   Panthera tigris altaica (Amur tiger): 102969928
Entry
102969928         CDS       T02988                                 

Definition
(RefSeq) xanthine dehydrogenase/oxidase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00232  Caffeine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102969928
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102969928
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102969928
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102969928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102969928
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     102969928
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     102969928
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   102969928
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 102969928
NCBI-ProteinID: XP_015399896
LinkDB
Position
Un
AA seq 845 aa
LRVSCFSRGIEMKFKNKLFPKMVCPAWIPELNSVEHGPEGISFGASCPLSFVEKTLLDAV
ANLPAHQTEVFKGVLEQLRWFAGKQVKSVASIGGNIITASPISDLNPVFMASGAKLTIVS
TGTRRTVRMDHTFFPAYRKTLLAPEEILLSIEIPYSREGEYFSAFKQASRREDDIAKVTS
GMRVLFNPGTAQVKELALCYGGMHDRTVSALKTTRKQIANFWNEELLQNVCAGLAEELSL
APDAPGGMVEFRRTLTLSFFFKFYLTVLQKLGIQNSKDKCGKLDPTHASATLLFQKDPPA
NVQLFQEVPKGQCEEDMVGRPLPHLAAAMQASGEAVYCDDIPRYENELSLRLVTSTRAHA
KIKSIDTSEAQKVPGFVCFISADDVPGSNITGIGNDEMVFAKDKVTYLYVVLDPFHPCWE
PRGYLCVSSWFLPRALGECTLLQQTPDHHEGHIASPGELYIGGQEHFYLETHCTIAVPKG
EAGEMELFVSTQNTTKTQSFVANMLGVPANRILVRVKRMGGGFGGKDTRSSLVSTAVALA
AYKTGCPVRCMLDRDEDMLITGGRHPFLARYKVGFMKTGRVVALKVEHYSNAGNTLDLSQ
SIMERALFHMDNCYNIPNIRGTGRMCKTNLPSNTAFRGFGGPQGMLIAEHWMSEVAVTCG
LPAEEVRRKNMYKEGDLTHFNQKLEGFTLPRCWEECLASSQYHARKREVDKFNEENCWKK
RGLSIIPTKFGISFSVPFLNQGGALVHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALK
IPTSKIYISETSTNTVPNTSPTAASVSTDLNGQAIYEACQTILKRLEPFKKKNPSGSWED
WVSLS
NT seq 2538 nt   +upstreamnt  +downstreamnt
cttcgggtttcttgtttttctcgaggcattgagatgaaatttaagaataagctatttcct
aagatggtctgcccagcctggatccctgagctgaattcagtggagcatggacctgagggt
atctccttcggagcctcgtgtcccttgagctttgtggaaaagacgctgctcgatgcagtc
gccaaccttcctgcccaccaaacagaggtgttcaaaggtgttttggagcagctgcgctgg
tttgctgggaagcaggtcaagtctgtggcgtccatcggagggaacatcatcaccgccagc
cccatctctgacctcaaccctgtgttcatggccagtggggccaagctgaccatcgtgtcc
acaggcaccaggaggacggttcggatggatcacaccttcttccccgcgtacagaaagacc
ctgctagctccggaggagatactgctttccatcgagatcccctacagcagggagggtgag
tatttctcagcctttaagcaggcctctcggagagaagatgacatcgccaaggtgaccagc
ggcatgagggtcctgttcaacccgggaaccgcgcaggtgaaggagctggccctttgctac
ggcggaatgcacgacagaaccgtctcggccctcaagaccacgcggaagcagatagcaaat
ttctggaacgaggagctgctgcagaacgtgtgtgcgggcctggcggaggagttgtccctg
gcccccgacgcccctggcggcatggtggagtttcggcgtaccctcaccctcagcttcttc
ttcaagttctacctgacagtgcttcagaaactgggcatacagaactcgaaagataagtgc
ggcaagctggaccccacccatgccagtgccaccttactctttcagaaagaccctccagcc
aacgtccagctcttccaagaggtgcccaagggtcagtgcgaggaggacatggtgggtcgg
cccctgccccacctggccgcggccatgcaagcgtctggggaggcggtatactgtgacgac
atccctcgctacgagaatgagctgtccctccggttggtcaccagcacccgggcccacgcc
aagatcaagtccatagatacttcagaagctcagaaggtgccagggtttgtctgctttatc
tctgctgatgatgttcccgggagtaatataactggaattggtaatgatgaaatggtgttt
gcaaaggataaggttacatatctgtatgtggttctggacccttttcacccctgctgggaa
cctagagggtacctgtgtgtgagcagctggttcctgcccagggccctaggggagtgcact
ctccttcagcaaactccggatcaccatgagggtcacattgcctccccaggcgagttgtac
attggtggccaagagcacttctacctggagactcactgcaccatcgctgtccccaaaggc
gaggcaggggagatggagctctttgtgtctacacagaacaccacgaagacccagagcttt
gttgcaaacatgttgggggttccggcaaaccggattttggtccgggtgaagagaatggga
ggaggctttggagggaaagacacccggagcagtctggtgtctacagcagtggccctggct
gcatacaagacgggctgccctgtgcgctgcatgctggatcgtgacgaggacatgctgata
actggtggcagacatcccttcttggccagatacaaggttggcttcatgaagactgggagg
gttgtggctctgaaggtggagcattacagtaatgcagggaacaccctggatctctcccag
agtataatggaacgagctctattccacatggacaactgttataacatccccaacatccgg
ggcactgggcggatgtgcaagaccaacctgccctccaacacggctttcaggggctttggg
gggccccagggaatgctcattgctgagcattggatgagtgaagtcgcagtgacctgtggg
ctgccggcagaggaagtgcgaaggaaaaacatgtataaggaaggggacctgacccacttc
aaccagaagcttgaggggttcaccttgcccaggtgctgggaggaatgcctagcaagctct
cagtatcatgcccggaagagggaggttgacaagttcaacgaggagaattgttggaagaag
agagggttgtccataattcctaccaagtttggaataagcttctctgttccttttctgaat
cagggaggagccctggttcacgtgtacacagatggctctgtgctgctgacccatggaggc
actgagatgggccaaggccttcacaccaagatggtccaggtggccagcagagcactgaaa
atccccacctctaagatttacatcagcgagacaagcacgaacaccgtgcctaacacgtct
cccacagctgcctccgtcagcactgacctcaacggacaggccatctatgaagcttgtcag
accattctgaaaaggctggaacccttcaagaaaaagaatcccagtggctcctgggaagac
tgggtaagtctgagctga

DBGET integrated database retrieval system