KEGG   Panthera tigris altaica (Amur tiger): 102970352Help
Entry
102970352         CDS       T02988                                 

Definition
(RefSeq) cationic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04080  Neuroactive ligand-receptor interaction
ptg04972  Pancreatic secretion
ptg04974  Protein digestion and absorption
ptg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102970352
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102970352
   04974 Protein digestion and absorption
    102970352
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102970352
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102970352
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102970352
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102970352
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102970352
NCBI-ProteinID: XP_007090895
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCPRNSVPYQVSLNSGYHFCGGSLINSLWVVS
AAHCYKSRIQVRLGEHNIAVSEGSEQFINSAKVIRHPRYNANTIDNDIMLIKLSSPATLN
SRVSAISLPRSCAPSGSQCLISGWGNVQSFGENYPDVLQCLKAPILTDSACRKAYPGQIT
SNMICLGFLEGGKDSCQGDSGGPVVCNNQLQGIVSWGAGCAQRGKPGVYTKVCNYVSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccttcatcttccttgctctcctgggagctgctgttgctttccccgttgatgac
gatgacaagatcgttgggggctacacctgtccgaggaactctgtcccctaccaggtgtcc
ctgaactcgggctaccacttctgtggcggctccctcatcaattccctgtgggtggtgtct
gcggctcactgctacaagtcccgaatccaggtgcgtctgggagaacacaacattgcagtc
tctgagggcagtgaacaattcatcaattcggccaaggtcatccgccacccgagatacaat
gcaaacactattgataacgacatcatgctgattaaattgagctcacctgccaccctcaac
tctcgagtgtctgctatctctctgccaagatcttgtgcaccttctggttcccagtgcctc
atctctggctggggaaatgtccagagctttggggaaaattatcccgatgtcctgcagtgt
ctgaaagctcccatactaactgacagtgcttgccgtaaagcctacccaggccagatcacc
agcaacatgatctgtctgggcttcctggaaggcggaaaggactcttgccagggtgactct
ggtggccctgtggtctgcaacaaccagctccagggcattgtctcctggggtgccggctgc
gctcaaagaggcaaacccggtgtctacaccaaggtctgcaactacgtgagctggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system