KEGG   Panthera tigris altaica (Amur tiger): 102970593
Entry
102970593         CDS       T02988                                 

Gene name
UMPS
Definition
(RefSeq) uridine monophosphate synthetase
  KO
K13421  uridine monophosphate synthetase [EC:2.4.2.10 4.1.1.23]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102970593 (UMPS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102970593 (UMPS)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     102970593 (UMPS)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.23  orotidine-5'-phosphate decarboxylase
     102970593 (UMPS)
SSDB
Motif
Pfam: OMPdecase Pribosyltran
Other DBs
NCBI-GeneID: 102970593
NCBI-ProteinID: XP_007098349
LinkDB
Position
Un
AA seq 482 aa
MAAQEADLESLVTGLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRLLSQVAEILFQT
AQNAGINFDAVCGVPYTALPLATVICSTNQIPMLIRRKESKDYGTKRLVEGAVNPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAHGIHLHSVCTLSKML
EILERQKKIDAEMVERVKRFIQENVFVAASHNGSLRSVNKAPAPGELSFGARAELPRVHP
VAAKLLRLMQKKETNLCLSADISESRELLQLADALGPSICMLKTHVDILNDFTLDVMKEL
TTLAKRHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVRGLREVG
LPLHRGCLLIAEMSSAGSLATGNYTTAAVKMAEEHSEFVVGFISGSRVSMKPEFLHLTPG
VQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIIMSSNRLEAAELYRKAAWEAYLSRL
GI
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcagcccaagaagcggatttggagtcgttggtaacgggtttgtacgacgtgcaggct
tttaaatttgggaacttcgtactgaagagcgggctctcttcccccgtttacatcgatctg
cgcggcatcgtgtctcgaccacgtcttctcagtcaggttgcagaaattttattccaaact
gcccaaaatgcgggaatcaattttgacgctgtgtgtggagtaccttatacagctttacca
ttggctacagttatctgttcaaccaaccaaattccaatgcttattagaaggaaagaatca
aaggattatggtactaagcgtcttgtagaaggggcggttaatccaggagaaacctgtttg
atcattgaagatgtcgttaccagtggatctagtgttctggaaactgttgaggttcttcag
aaggagggtttgaaggtcactgatgccatagtgctgctggacagagagcaaggaggcaaa
gacaagttgcaggcacatgggatccatcttcactcagtgtgtacattgtccaaaatgctg
gagattctcgagcgacagaaaaaaattgatgctgagatggtcgagagagtgaagagattt
attcaggagaatgtttttgtagcagctagtcataatggttctctccgttctgtaaacaaa
gctcccgctcctggagaactcagctttggtgcacgtgcagagctgcccagggtccaccca
gttgcagcgaagcttctcaggcttatgcaaaagaaagagactaatctgtgtctgtctgca
gatatttcagagtctagagagctgttgcagctagctgatgctttaggacccagcatctgc
atgctcaagactcatgtagatattttgaatgattttactctggatgtgatgaaggagtta
acaactctggcaaaacgccacgagttcttaatatttgaagaccggaagtttgcagatata
ggaaatacagtaaaaaaacagtatgaaggtggtatctttaaaatagcttcttgggcagat
ctggtcaatgctcacgtggtgcctggttcgggggtcgtgagaggcctgagagaagtaggc
ctgcctttgcaccgggggtgcctgctcattgcagaaatgagctctgctggctccttggct
acaggcaactacacgacagcagcggttaaaatggctgaagagcattctgagtttgtggtt
ggttttatctctggctcccgagtaagcatgaaaccagaatttcttcacttgactccagga
gttcagttagaagcaggaggggataatcttggccaacagtataatagcccacaagaagtt
attggcaaacgaggatctgatatcatcattgtaggccggggcataataatgtcatcaaat
cgtctggaagcagctgagttgtaccgaaaagctgcttgggaagcttatttgagtagactt
ggaatttga

DBGET integrated database retrieval system