KEGG   Panthera tigris altaica (Amur tiger): 102970633Help
Entry
102970633         CDS       T02988                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04080  Neuroactive ligand-receptor interaction
ptg04972  Pancreatic secretion
ptg04974  Protein digestion and absorption
ptg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102970633
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102970633
   04974 Protein digestion and absorption
    102970633
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    102970633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptg01002]
    102970633
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102970633
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102970633
Peptidases [BR:ptg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102970633
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102970633
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 102970633
NCBI-ProteinID: XP_007090896
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MTPLLILAFVGAAVAFPTDDDDKIVGGYTCEENSIPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEHNIEVLEGDEQFINSAKVIRHPRYNSWTLDYDIMLIKLSSPAALT
ARVSTISLPSACAPAGTQCLISGWGNTLSSGTNYPELLQCLDAPLLSQAQCKAAYPGQIT
ENMVCAGFLEGGKDSCQGDSGGPVVCKGELQGIVSWGYGCAQKNKPGVYTKVCNFTDWIK
ETIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactccactcctgatccttgcttttgtgggagctgctgttgctttccccactgacgac
gatgacaagatcgttgggggctatacgtgtgaggagaactccatcccctaccaggtgtcc
ctgaactcgggctaccacttctgcggcggctccctcatcagtgaccagtgggtggtgtct
gcggctcactgctacaagtctcgcatccaagtgaggctcggagagcacaacatcgaagtc
ctggagggggatgagcagttcatcaactcggccaaggtcatccgccaccccagatataac
agctggactctggactatgacatcatgcttatcaagctctcctcacctgcagccctcact
gcccgggtgtccaccatatcgctgccctccgcctgtgcccccgccggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcaccaactacccggagctgctacagtgc
ctggacgccccgctgctgagccaggcccagtgtaaagccgcctaccccgggcagatcacg
gagaacatggtttgcgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtctgcaaaggagagctccagggcatcgtctcctggggctatggctgt
gcccagaagaacaagcctggcgtctacaccaaggtgtgcaactttacagactggattaag
gagacgatagcagccaacagctaa

DBGET integrated database retrieval system