KEGG   Panthera tigris altaica (Amur tiger): 102970685Help
Entry
102970685         CDS       T02988                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102970685 (SETD1B)
Enzymes [BR:ptg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102970685 (SETD1B)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102970685 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     102970685 (SETD1B)
    COMPASS/SET1 complex (yeast)
     102970685 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 102970685
NCBI-ProteinID: XP_007079712
LinkDB All DBs
Position
Un
AA seq 1571 aa AA seqDB search
SPNSLPPRPCQIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKT
KKHLGIAKVVFATVRGAKEAGQHLHSHSGPGNIXSLALPTGETRMRFYELLVTGRYTPQT
LPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGSGSSSVTPNSGGTPFSQDTAYSSS
RLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTVTFKARRHESKFTDAY
NRRHEHHYVHNSCAVTAVAGAPAAFRGSVDLPFGAVSSSGGSSGPPFKAQPQDSATFAHT
PPPAQATPAPGVTFKSAFSPYQTPVPPFPPPPEEPTTATTFGARESGEFRRAPVPPPLPP
TQPPTKEKPGTPPGPPPPDANSMELGGRPTFGWSPEPCDSPGTPTLESSPAGLEKPHDSL
DSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTP
PSSRPSSTGLEDISPTPLPDSDEDDELDLGVGPRPPPEPGPPDPSGLLGQTTEVALDLAG
DRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAAAVAAPSGGQWGG
MPMSFQMQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGR
GQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAF
RAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLG
IGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELA
KRDPKGVGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEER
ESTEEEEEGEEEEEEEDEEEEEEEEEEEEGPRSQVSSSSTSATSDKDDDAEDSDEQEESE
NEDEDIALSEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDE
EELVAREEEEEEEEEEQEEQEEETAAADESMAPAAPDEDFEEDVATGAPVTESSVTEGEV
DIEAEDGAPEERTSVLEEPPLPVCVEELAGCKEPSEEPGLKQEGARLLSPEPPAGETEAR
PPPSPEPAPEDDLEVAPESPTLLSLPLQPPLPPPRPPRPPSPPPNPVEPTKLPFKELENQ
WPSEAIPPGPRGRDEVTEEFMDLAKVRGPWRRPPKKRHEDLVASASPELSPPQPLFRPRS
EFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKK
KRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRA
GSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMV
IEYVGQNIRQVGTARQAGSRGGSGWRPPPVSSSPAPRYEDEGIGSSYMFRVDHDTIIDAT
KCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCL
CGSENCRGTLN
NT seq 4716 nt NT seq  +upstreamnt  +downstreamnt
tctccaaactcccttccccctcgtccctgccagatcgatgagttctacgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgagaaaacttcctgagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccctaagacc
aagaagcacttgggcattgccaaggtggtctttgccacggtcaggggagccaaagaggcg
ggtcagcacctgcatagccattcgggcccgggcaatatancctcccttgcccttcccaca
ggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacacaccccagacc
ctcccagtgggtgagctggacgctgtctctccaatcgtgaatgagaccctgcagctgtca
gatgctctgaagcgcctcaaggacggtagtctgtctgcaggctgtggctccggctcctcc
tcggtcacccccaatagtggtgggacacccttctcccaggacacggcgtactccagcagc
cgcctggacacccccaactcctacggacagggcacaccgctcacgccacgtctgggcacc
cccttctcgcaggactccagctactccagccgccagcccacaccctcctacctcttcagc
caggaccccacggtgaccttcaaagcccggcgccacgaaagcaagttcacagacgcctac
aaccgccgccacgagcatcattatgtccacaactcctgtgcggtcaccgcagtggccggg
gccccagctgccttcaggggctccgtggacctcccgtttggggcagtcagcagcagtggg
ggcagcagtggccctccattcaaggcccaaccacaggattcggccacgttcgcccacact
ccaccgcctgcccaagcaacccccgctcctggagtcacgttcaagtcggctttctctccg
tatcagacccctgtgcccccttttcccccaccccctgaggagcccaccaccgcaaccacc
tttggggcccgtgagagtggggaattccggagagctcctgtgcccccacccctgccaccc
acccaaccccccaccaaggagaagccaggcacaccgcccggcccaccgccccctgatgcc
aacagcatggagctgggtggccggccgacctttggctggagccctgagccttgtgacagt
ccaggcacacctacgctggagtcctcacctgcggggctggagaagccccacgacagcctg
gactcacgcatagagatgctgctgaaggaacagcgcaccaagctgcccttccttcgagag
caggactcggatacggagctgcagatggagggcagccccatctcctcctcctcctcccag
ctctccccactggccccctttggcaccaactcccagccaggctttcgaggccccacgcca
ccctcctcacgcccctccagcaccggcctggaggatatcagccccacgccgctacccgac
tcagacgaggatgatgagcttgacctgggcgtggggccccgcccccctccggagccaggc
cccccggacccttctggtcttctgggccagacaactgaggtagccttggacctggctgga
gacaggaccccaacctcagagaagatggatgagggccagcagtcctcgggcgaggacatg
gaaatctcggacgatgagatgccctcagcccccatcaccagcgccgactgccccaaaccc
atggtggtgaccccaggggcggcagctgtggcagccccctctggtggccagtggggcggc
atgcccatgtccttccagatgcaaacgcagatgctgagccgtctgatgactggccagggc
gcctgcccctacccgcccttcatggccgctgctgccgcagccgcctcagccgggctgcag
tttgtcaacctgccgccctaccggggcccgttctccctgagcaacagcggaccgggccgc
gggcagccctggccaccgctacccaagttcgacccgtcagtgccgccaccaggctacgtg
ccacgccaggaggacccacacaaggccactgtggatggcgtcctgctggtggtgctcaaa
gagctgaaggccatcatgaagcgtgacctgaaccgcaagatggtggaggtggtggctttc
cgcgcctttgacgagtggtgggacaagaaggagcggatggccaaggcctctctgaccccg
gtgaagtcaggcgagcacaaggacgaggacaggccaaagcccaaggaccgcatcgcctcg
tgcctgctggagtcgtggggcaagggcgagggcctgggctatgagggcctcggcctgggc
atcgggctgcgcggggccatccgcctgccctccttcaaggtcaagaggaaggagccgcca
gacacagcctcttctggtgaccagaagcgcctgcggccctcaacctctgtggacgaggaa
gatgaagagtcagagcgagaacgggaccgggatatggcggacgccccttgtgagcttgcc
aagcgggaccccaagggcgtgggcgtgcggcgccggccagcccggccgctggagctggac
agtggcggggaggaggatgagaaggagtcactgtcggtgtcctcatcgtcatcggcgtcc
tcatcctcgggctcctccacgacctcaccctcatcctcggcctctgacaaggaggagcgg
gaaagcactgaggaggaagaggagggggaggaggaggaggaggaggaggatgaagaggag
gaggaggaggaggaggaggaggaggaaggccccaggagccaggtctcctcctcctcgacc
tcagccacatcagataaggatgatgacgctgaagacagcgatgagcaggaggagtctgag
aatgaggacgaggacatagccctgtcagaggcgagtgagaaggaagaaggggactcggac
ggagaggagacggtgagcatcgccacgtccaaggcaggagctgggtcctccagcgagagt
tctgagtcttctgagttcgaatcaagctccgagtcctcatcgtcatcctcagaggatgaa
gaggagctggtggcaagggaggaggaggaggaggaggaagaggaggagcaggaggagcag
gaggaggagaccgcagcagcagacgagagtatggctcctgctgctcccgatgaggacttt
gaggaggatgtggccacgggggctcctgtgacagagtcctcggtcacggaaggggaggtg
gacatcgaggctgaggacggagctcccgaggagcggacttccgtgctggaagagcccccc
ttgcctgtgtgtgtcgaagagctcgcaggctgcaaggagccctcggaggaaccgggcctg
aagcaagaaggggccaggttgctgtctccagagccccctgctggagagacggaggcccgg
ccccccccttccccggagcccgccccagaggatgacctggaagtggcgcccgagtcccct
acgctgctctccttaccactgcagccgccattgccaccccctcgaccaccccggccgcct
agcccaccgccaaaccctgttgagcctaccaagctgccctttaaggagctagagaaccag
tggccctccgaggccatccctccaggcccccgtgggcgcgatgaggtcaccgaggagttc
atggacctggccaaggttcgggggccctggcgccggccgcctaaaaaacgccacgaggac
ctggtggcctcagcctcgcccgagctctcaccgccgcagcccctcttccggccccggtcg
gagtttgaggagatgaccatcctgtacgacatctggaacggtggcatcgacgaggaggac
atccgcttcctgtgtgtcacttacgagcggctgctgcagcaggacaatggcatggactgg
ctcaacgacacactctgggtctaccatccctccaccagcctctcttcagctaagaaaaag
aaacgggacgatggcatccgtgagcacgtgacgggctgtgcccgcagcgagggtttctac
accatcgacaagaaggacaagctcagatacctcaacagcagccgcgccagcaccgatgag
cccccgacagacacccagggcatgagcatcccggcacagccacacgcctccactcgggcc
ggctcggagcggcgttctgaacagcgccgcctcctgtcctccttcactggcagctgtgac
agtgacctgctcaagttcaaccagctcaagttccggaagaagaagctcaaattctgcaag
agccacattcacgactggggcctgttcgccatggagcccatcgcggccgacgagatggtc
attgagtacgtgggccagaacatccgccaggtaggcaccgcccggcaggctgggagcagg
ggcgggagcgggtggcggccgccccccgtcagcagctctcccgcgccgcgttatgaggac
gagggcatcggcagcagctacatgttccgggtggaccacgacaccatcatcgacgccacc
aagtgcggcaacttcgcgcgcttcatcaaccacagctgcaaccccaactgctatgccaag
gtgatcacggtggagtcgcagaagaagatcgtcatctactcaaagcagcacatcaacgtc
aatgaggagatcacctacgactacaagttccccatcgaggacgtcaagatcccctgcctg
tgcggctccgagaactgccgggggaccctcaactag

DBGET integrated database retrieval system