Panthera tigris altaica (Amur tiger): 102970767 Help Entry 102970767         CDS       T02988                                  Gene name BAK1 Definition (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01524   Platinum drug resistance ptg04141   Protein processing in endoplasmic reticulum ptg04210   Apoptosis ptg04215   Apoptosis - multiple species ptg05022   Pathways of neurodegeneration - multiple diseases ptg05132   Salmonella infection ptg05160   Hepatitis C ptg05162   Measles ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05168   Herpes simplex virus 1 infection ptg05169   Epstein-Barr virus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05202   Transcriptional misregulation in cancer ptg05203   Viral carcinogenesis ptg05206   MicroRNAs in cancer ptg05210   Colorectal cancer ptg05212   Pancreatic cancer ptg05213   Endometrial cancer ptg05214   Glioma ptg05216   Thyroid cancer ptg05217   Basal cell carcinoma ptg05218   Melanoma ptg05220   Chronic myeloid leukemia ptg05222   Small cell lung cancer ptg05223   Non-small cell lung cancer ptg05224   Breast cancer ptg05225   Hepatocellular carcinoma ptg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102970767 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102970767 (BAK1)    04215 Apoptosis - multiple species     102970767 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102970767 (BAK1)    05202 Transcriptional misregulation in cancer     102970767 (BAK1)    05206 MicroRNAs in cancer     102970767 (BAK1)    05203 Viral carcinogenesis     102970767 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     102970767 (BAK1)    05212 Pancreatic cancer     102970767 (BAK1)    05225 Hepatocellular carcinoma     102970767 (BAK1)    05226 Gastric cancer     102970767 (BAK1)    05214 Glioma     102970767 (BAK1)    05216 Thyroid cancer     102970767 (BAK1)    05220 Chronic myeloid leukemia     102970767 (BAK1)    05217 Basal cell carcinoma     102970767 (BAK1)    05218 Melanoma     102970767 (BAK1)    05213 Endometrial cancer     102970767 (BAK1)    05224 Breast cancer     102970767 (BAK1)    05222 Small cell lung cancer     102970767 (BAK1)    05223 Non-small cell lung cancer     102970767 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     102970767 (BAK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102970767 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102970767 (BAK1)    05160 Hepatitis C     102970767 (BAK1)    05164 Influenza A     102970767 (BAK1)    05162 Measles     102970767 (BAK1)    05168 Herpes simplex virus 1 infection     102970767 (BAK1)    05163 Human cytomegalovirus infection     102970767 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102970767 (BAK1)    05169 Epstein-Barr virus infection     102970767 (BAK1)    05165 Human papillomavirus infection     102970767 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102970767 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ptg03029]     102970767 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ptg02000]     102970767 (BAK1) Mitochondrial biogenesis [BR:ptg03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     102970767 (BAK1) Transporters [BR:ptg02000]  Other transporters   Pores ion channels [TC:1]    102970767 (BAK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102970767 NCBI-ProteinID:  XP_007093269 LinkDB All DBs Position Un AA seq 211 aa AA seqDB search MASGQGPGPPRQECEEPAPSATSEEQVARDTEEVFRSYVFHRYQQEQEAEGAAAPTDPEI VTLPLEPSSTMGQVGRQLAIIGDNINQRYDSEFQAMLQRLQPTAENAYELFTKIASSLFE SGINWGRVVALLGFGYRLALHIYQHGLTGFLGQVTKLVVDVMLRHCIARWIAQRGGWVAA LNLGNGPIVNVLIVLSVVLLGQFVVRRFFKS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcatccgggcaaggcccaggtcctcccaggcaggagtgtgaagagcctgccccgtct gctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt caccgttatcagcaggagcaggaggctgagggggcagctgcgcctactgacccagaaata gtcaccttgcccctagaacctagcagcaccatggggcaggtgggtcggcagctcgctatc attggggacaacatcaaccagcgctatgattcagagttccaggccatgctgcagcgcctg caacccacagcagagaacgcctatgaacttttcaccaagattgcctcgagtctatttgag agcggcatcaactggggccgagtggtggctctcctgggctttggctaccgcctggctcta cacatctaccagcatggcctgaccggcttcctgggccaggtgaccaaactggtggtcgac gtcatgctgcgtcactgcattgcccggtggattgcgcagaggggcggctgggtggcagcc ctgaacttgggaaatggccccatcgtgaacgtgctgatagttctgtctgtggttctgttg ggccagttcgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system