KEGG   Panthera tigris altaica (Amur tiger): 102970767
Entry
102970767         CDS       T02988                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04141  Protein processing in endoplasmic reticulum
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05132  Salmonella infection
ptg05160  Hepatitis C
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05165  Human papillomavirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05216  Thyroid cancer
ptg05217  Basal cell carcinoma
ptg05218  Melanoma
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102970767 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102970767 (BAK1)
   04215 Apoptosis - multiple species
    102970767 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102970767 (BAK1)
   05202 Transcriptional misregulation in cancer
    102970767 (BAK1)
   05206 MicroRNAs in cancer
    102970767 (BAK1)
   05203 Viral carcinogenesis
    102970767 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102970767 (BAK1)
   05212 Pancreatic cancer
    102970767 (BAK1)
   05225 Hepatocellular carcinoma
    102970767 (BAK1)
   05226 Gastric cancer
    102970767 (BAK1)
   05214 Glioma
    102970767 (BAK1)
   05216 Thyroid cancer
    102970767 (BAK1)
   05220 Chronic myeloid leukemia
    102970767 (BAK1)
   05217 Basal cell carcinoma
    102970767 (BAK1)
   05218 Melanoma
    102970767 (BAK1)
   05213 Endometrial cancer
    102970767 (BAK1)
   05224 Breast cancer
    102970767 (BAK1)
   05222 Small cell lung cancer
    102970767 (BAK1)
   05223 Non-small cell lung cancer
    102970767 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102970767 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102970767 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102970767 (BAK1)
   05160 Hepatitis C
    102970767 (BAK1)
   05164 Influenza A
    102970767 (BAK1)
   05162 Measles
    102970767 (BAK1)
   05168 Herpes simplex virus 1 infection
    102970767 (BAK1)
   05163 Human cytomegalovirus infection
    102970767 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102970767 (BAK1)
   05169 Epstein-Barr virus infection
    102970767 (BAK1)
   05165 Human papillomavirus infection
    102970767 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102970767 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ptg03029]
    102970767 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102970767 (BAK1)
Mitochondrial biogenesis [BR:ptg03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102970767 (BAK1)
Transporters [BR:ptg02000]
 Other transporters
  Pores ion channels [TC:1]
   102970767 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102970767
NCBI-ProteinID: XP_007093269
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPRQECEEPAPSATSEEQVARDTEEVFRSYVFHRYQQEQEAEGAAAPTDPEI
VTLPLEPSSTMGQVGRQLAIIGDNINQRYDSEFQAMLQRLQPTAENAYELFTKIASSLFE
SGINWGRVVALLGFGYRLALHIYQHGLTGFLGQVTKLVVDVMLRHCIARWIAQRGGWVAA
LNLGNGPIVNVLIVLSVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccgggcaaggcccaggtcctcccaggcaggagtgtgaagagcctgccccgtct
gctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt
caccgttatcagcaggagcaggaggctgagggggcagctgcgcctactgacccagaaata
gtcaccttgcccctagaacctagcagcaccatggggcaggtgggtcggcagctcgctatc
attggggacaacatcaaccagcgctatgattcagagttccaggccatgctgcagcgcctg
caacccacagcagagaacgcctatgaacttttcaccaagattgcctcgagtctatttgag
agcggcatcaactggggccgagtggtggctctcctgggctttggctaccgcctggctcta
cacatctaccagcatggcctgaccggcttcctgggccaggtgaccaaactggtggtcgac
gtcatgctgcgtcactgcattgcccggtggattgcgcagaggggcggctgggtggcagcc
ctgaacttgggaaatggccccatcgtgaacgtgctgatagttctgtctgtggttctgttg
ggccagttcgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system