KEGG   Panthera tigris altaica (Amur tiger): 102971089Help
Entry
102971089         CDS       T02988                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01524  Platinum drug resistance
ptg05200  Pathways in cancer
ptg05204  Chemical carcinogenesis
ptg05225  Hepatocellular carcinoma
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102971089 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102971089 (MGST3)
   00982 Drug metabolism - cytochrome P450
    102971089 (MGST3)
   00983 Drug metabolism - other enzymes
    102971089 (MGST3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102971089 (MGST3)
   05204 Chemical carcinogenesis
    102971089 (MGST3)
   05225 Hepatocellular carcinoma
    102971089 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102971089 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    102971089 (MGST3)
Enzymes [BR:ptg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102971089 (MGST3)
Transporters [BR:ptg02000]
 Other Transporters
  Pores ion channels [TC:1]
   102971089 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102971089
NCBI-ProteinID: XP_007078171
LinkDB All DBs
Position
Un
AA seq 152 aa AA seqDB search
MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPENGHLFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPSKRSRGAIGSI
ALLGLLGTTVCSAFQHLGWVKTGLGGGSKCCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcctctctaaggagtatggttttgtggttctgaccggcgccgccagctttatc
atggtagctcacctggccatcaacgtttccaaggcccgaaagaagtacaaagtggagtat
ccaaccatgtacagcacggaccctgaaaacgggcaccttttcaactgcattcagcgcgcc
caccagaacacgttggaagtgtatcctcctttcttatttttcctagctgttggaggtgtt
taccacccgcgtgtagcttccggcttgggcttggcctggatcgtgggacgagttctctac
gcgtatggttattacacaggagaacccagcaagcggagtcggggcgccatcggctccata
gccctccttggcctgctgggcacaaccgtgtgttctgccttccagcatcttggttgggtt
aaaaccggcttgggcggggggtccaaatgctgccattga

DBGET integrated database retrieval system