KEGG   Panthera tigris altaica (Amur tiger): 102971802
Entry
102971802         CDS       T02988                                 

Gene name
IL12A
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04620  Toll-like receptor signaling pathway
ptg04622  RIG-I-like receptor signaling pathway
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04940  Type I diabetes mellitus
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05162  Measles
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05200  Pathways in cancer
ptg05321  Inflammatory bowel disease
ptg05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102971802 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102971802 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102971802 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    102971802 (IL12A)
   04625 C-type lectin receptor signaling pathway
    102971802 (IL12A)
   04658 Th1 and Th2 cell differentiation
    102971802 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102971802 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102971802 (IL12A)
   05330 Allograft rejection
    102971802 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102971802 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102971802 (IL12A)
   05134 Legionellosis
    102971802 (IL12A)
   05152 Tuberculosis
    102971802 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102971802 (IL12A)
   05164 Influenza A
    102971802 (IL12A)
   05162 Measles
    102971802 (IL12A)
   05168 Herpes simplex virus 1 infection
    102971802 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102971802 (IL12A)
   05144 Malaria
    102971802 (IL12A)
   05145 Toxoplasmosis
    102971802 (IL12A)
   05140 Leishmaniasis
    102971802 (IL12A)
   05142 Chagas disease
    102971802 (IL12A)
   05143 African trypanosomiasis
    102971802 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102971802 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102971802 (IL12A)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102971802 (IL12A)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102971802 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 102971802
NCBI-ProteinID: XP_007086316
LinkDB
Position
Un
AA seq 222 aa
MCPPRGLLLVTILVLLNHLDHLSLARSLPTPTPSPGMFQCLNHSQTLLRAISNTLQKARQ
TLEFYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKTS
FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQNMLTAIDELLQALNVNSVTV
PQNSSLEEPDFYKTKIKLCILLHAFRIRAVTINRMMNYLNSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgtgcccgccgcgtggcctcctccttgtaaccatcctggtcctattaaaccacctggac
cacctcagtttggccaggagcctccccacacccacaccaagcccaggaatgttccagtgc
ctcaaccactcccaaaccctgctgcgagccatcagcaacacgcttcagaaggccagacaa
actctagaattttactcctgcacttccgaagagattgatcatgaagatatcacaaaagat
aaaaccagcacagtggaggcctgcttaccactggaattaaccatgaatgagagttgcctg
gcttccagagagatctctctgataactaatgggagttgcctggcctccagaaagacctct
tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag
ttcaaggccatgaatgcaaagctgttaatggatcctaaaaggcagatctttctggatcaa
aacatgctgacagctattgatgagctgttacaggccctgaatgtcaacagtgtgactgtg
ccacagaactcctccctggaagaaccggatttttataaaactaaaatcaagctctgcata
cttcttcatgctttcagaattcgtgcagtgaccatcaatagaatgatgaactatctgaat
tcttcctaa

DBGET integrated database retrieval system