KEGG   Panthera tigris altaica (Amur tiger): 102972301
Entry
102972301         CDS       T02988                                 

Gene name
GGCT
Definition
(RefSeq) gamma-glutamylcyclotransferase
  KO
K00682  gamma-glutamylcyclotransferase [EC:4.3.2.9]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102972301 (GGCT)
Enzymes [BR:ptg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     102972301 (GGCT)
SSDB
Motif
Pfam: AIG2_2 GGACT ChaC
Other DBs
NCBI-GeneID: 102972301
NCBI-ProteinID: XP_007090604
LinkDB
Position
Un
AA seq 188 aa
MANSGCEDLRGQEGESFLYFAYGSNLLTERIHLRNPSAVFCCVARLQDFKLDFGNSQGKT
SETWHGGIATIFQSPGDEVWGVVWKMNKSNLSSLDEQEGVKSGTYVPIEVNVYTQEGKEI
TCRSYQMKNYESAPPSPQYKKVICLGAKENGLPLEYQKKLNAIEPNDYKGEVSEEIEDII
KKGETKTH
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcgaattcgggctgtgaggacctccggggccaggagggggagagttttctgtacttc
gcctacggtagcaatctgctgaccgagcggatccacctccgaaacccgtcagccgtgttc
tgctgcgtggcccgcctgcaggattttaagcttgactttggcaattcccaaggcaaaaca
agtgaaacttggcatggaggtatagccaccatttttcaaagtcctggcgatgaagtatgg
ggagtagtatggaaaatgaacaaaagcaatttaagttctctggatgagcaagaaggagtt
aaaagtggaacatatgtcccaatagaagttaatgtttatactcaagaaggaaaagaaata
acttgtcgaagttatcagatgaaaaattatgagagtgctcccccatctccccagtataaa
aaggtcatttgcctaggtgcaaaagaaaatggtttgccactggagtatcaaaagaagtta
aatgcaatagaaccaaatgactacaaaggagaagtctcagaagaaattgaagacattatc
aaaaagggagaaacaaaaactcactag

DBGET integrated database retrieval system