KEGG   Panthera tigris altaica (Amur tiger): 102972472
Entry
102972472         CDS       T02988                                 

Gene name
SULT1A1
Definition
(RefSeq) sulfotransferase 1A1
  KO
K01014  aryl sulfotransferase [EC:2.8.2.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102972472 (SULT1A1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.1  aryl sulfotransferase
     102972472 (SULT1A1)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 102972472
NCBI-ProteinID: XP_007084118
LinkDB
Position
Un
AA seq 295 aa
MELVPDTSRPPLQYVKGIPLIKYFAEALGPLQNFQAQPDDLLISTYPKSGTTWVSEILDM
IYQGGDLEKCRRAPVFIRIPFLEFKAPGIPTGMEVLKDTPAPRIIKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYRMAKVHPDPDTWDSFLEKFMAGEVSYGSWYQHVREWW
ELSHTHPVLYLFYEDMKENPKREIQKILEFVGRTLPEETVDLITQQTSFKEMKKNPMANY
TTIPPDIMDHSVSAFMRKGVAGDWKTTFTVAQNERFDAHYAEKMAGCSLRFRTHL
NT seq 888 nt   +upstreamnt  +downstreamnt
atggagctggtcccggacacctcacgcccgccactgcagtacgtgaaggggatccctctc
atcaagtactttgccgaggcactggggccactgcagaacttccaggcccagcccgatgac
ctgcttatcagcacctaccccaaatccggcaccacctgggtgagcgaaatcctggacatg
atctaccaaggtggcgatctggagaagtgtcgcagggcccccgtctttatccggataccc
ttccttgagttcaaggctccagggattcccacaggtatggaggttctgaaagacacaccg
gccccacgaatcatcaagacgcacttgcccctggccctgctccctcagaccctgctggat
cagaaggtcaaggtggtctatgttgcccgcaacgcaaaggatgtggctgtctcctattac
cacttctaccgcatggccaaggtgcaccctgaccctgacacctgggacagcttcctggag
aagttcatggccggagaagtgtcctacgggtcctggtatcagcacgtgcgggagtggtgg
gagctgagtcatacccaccctgttctctacctcttctatgaggacatgaaagagaaccct
aaaagggaaattcagaagatcctggagtttgtggggcgcaccctgccagaggagaccgtg
gatctcatcacccagcaaacgtctttcaaggagatgaagaagaaccccatggctaactac
accaccataccccctgacatcatggatcacagcgtttcggccttcatgaggaaaggcgtc
gcgggggactggaagaccaccttcaccgtggcccagaacgagcgctttgacgcccactat
gcggagaagatggcgggctgcagcctccgcttccgcacgcacctgtga

DBGET integrated database retrieval system