KEGG   Panthera tigris altaica (Amur tiger): 102972473
Entry
102972473         CDS       T02988                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells
  KO
K07362  linker for activation of T cells
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04014  Ras signaling pathway
ptg04015  Rap1 signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04666  Fc gamma R-mediated phagocytosis
ptg05135  Yersinia infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102972473 (LAT)
   04015 Rap1 signaling pathway
    102972473 (LAT)
   04064 NF-kappa B signaling pathway
    102972473 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102972473 (LAT)
   04660 T cell receptor signaling pathway
    102972473 (LAT)
   04658 Th1 and Th2 cell differentiation
    102972473 (LAT)
   04659 Th17 cell differentiation
    102972473 (LAT)
   04664 Fc epsilon RI signaling pathway
    102972473 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    102972473 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102972473 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102972473 (LAT)
SSDB
Motif
Pfam: LAT LAX
Other DBs
NCBI-GeneID: 102972473
NCBI-ProteinID: XP_007084202
LinkDB
Position
Un
AA seq 220 aa
GLLLLPLLAVVLCVRCRELPGSYDNTASDSLAPSSIVIKRPPTLATWTPATSYPPVTSYP
PLSQPDLLPIPRSPQPPGGSHRMPSSRQDSDGANSVASYENEEPACEDDDEDEEEDYPNE
GYLEVLPDSTPATGTAVPPAPAPSNPGLRDSAFSMESGEDYVNVPESEESADVSLDGSRE
YVNVSQELPPVARTEPAILSSQNDDEEEGAPDYENLQGLN
NT seq 663 nt   +upstreamnt  +downstreamnt
ggcctcctgctgctgccgctgctggctgtggtgctgtgcgtgcggtgccgagagctgcca
ggctcctatgacaatacggcctctgacagcttggccccaagtagcatcgtgatcaaacgc
cctcccacactcgccacctggacaccagccacctcctatcctcctgttacctcctaccca
cccttgagccagccggacctgcttcccatcccgaggtccccacagccccctgggggctcc
caccgcatgccatcttcccggcaggactcagatggtgccaacagtgtggcgagctacgag
aacgaggagcccgcctgtgaggacgacgatgaagacgaggaggaggattatcccaacgag
ggctacttggaggtgcttcctgacagcacgccagcgacaggcactgctgtcccaccggct
cccgcgcccagcaaccccggcctccgagacagcgccttctccatggagtcgggggaggat
tacgtgaacgtccccgagagcgaggagagtgcagacgtgtctctggatgggagccgggag
tacgtgaatgtgtcccaggagctgccacccgtggctaggaccgagcctgccatcctgagc
tcccagaacgacgacgaggaagagggagctccagattatgagaatctgcaggggcttaac
tga

DBGET integrated database retrieval system