KEGG   Panthera tigris altaica (Amur tiger): 102972489
Entry
102972489         CDS       T02988                                 

Gene name
STAT5B
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04012  ErbB signaling pathway
ptg04062  Chemokine signaling pathway
ptg04217  Necroptosis
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04917  Prolactin signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102972489 (STAT5B)
   04630 JAK-STAT signaling pathway
    102972489 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102972489 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102972489 (STAT5B)
   04659 Th17 cell differentiation
    102972489 (STAT5B)
   04062 Chemokine signaling pathway
    102972489 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102972489 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    102972489 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102972489 (STAT5B)
   05203 Viral carcinogenesis
    102972489 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102972489 (STAT5B)
   05220 Chronic myeloid leukemia
    102972489 (STAT5B)
   05223 Non-small cell lung cancer
    102972489 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102972489 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102972489 (STAT5B)
   05161 Hepatitis B
    102972489 (STAT5B)
   05162 Measles
    102972489 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102972489 (STAT5B)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102972489 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_int SH2 STAT_alpha UPF0061
Other DBs
NCBI-GeneID: 102972489
NCBI-ProteinID: XP_015395499
LinkDB
Position
Un
AA seq 681 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGTSPVGSLADTMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQGEARAAWAVCVVRATRKFRSNWKRMGFLFRGTPLSVDNATITDIISALVTSTFIIEK
QPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEI
LNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELV
FQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFK
AEVQSNRGLTKENLVFLAQKLFNSSSSHLEDYNGMSVSWSQFNRENLPGRNYTFWQWFDG
VMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQ
ERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATGFSC
SSCRFVNASADSAGASATYVDQAPSPAVCPQAHYNLYPQNPDPVLDNDGDFDLDDTMDVA
RRVEELLGRPMDSQWIPHAQS
NT seq 2046 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctccaaggcgatgcccttcatcagatgcaagca
ttatatggtcagcatttccccattgaggtgcgacattatttatcccagtggattgaaagc
caagcttgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgccacgcagctccagaacacatatgaccgc
tgccccatggagctggtccgctgcatccggcatattctgtacaacgagcagaggctggtc
cgcgaagccaacaatggtacttctccagttggaagtcttgctgacaccatgtcccagaaa
cacctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacagagaat
gagctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggagagcctg
aggatccagggtgaggccagggccgcctgggcggtgtgtgttgtgagggctacaaggaaa
ttcaggtcaaattggaagagaatggggtttctgttcagaggcactcccctttctgtggac
aatgccaccatcacagacatcatctcagccctggtgaccagcacattcatcatcgagaag
cagccccctcaggtcctgaagacccagaccaagtttgcagcgacggtgcgcctgctggtg
ggcgggaagctgaacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgag
cagcaggccaagtcactgctcaagaatgagaacacccgcaacgactacagtggagagatc
ctgaacaactgctgtgtgatggaataccaccaagccaccggcaccctgagcgcgcacttc
aggaacatgtccctgaagcgaattaagaggtctgaccgtcgtggagcagagtcagtgact
gaagaaaaatttacaatcctgttcgaatcacagttcagtgttggtggaaatgagctggtt
tttcaggtcaagactctctccctcccggtggtggtgattgtccatggcagccaggacaac
aatgcgacggccactgttctttgggacaatgcttttgcagagcctggcagggtgccattt
gccgtgcccgacaaagtgctgtggccgcagctgtgtgaggcgctcaacatgaaattcaag
gccgaagtgcagagcaaccggggcctgaccaaggagaacctcgtgttcctggcacagaaa
ctgttcaacagcagcagcagccaccttgaagactataatggcatgtccgtgtcctggtcc
cagttcaacagggagaatttgccaggacgaaattacactttctggcagtggtttgatggt
gtgatggaagtgttaaaaaaacatctcaagcctcattggaatgatggggccattttgggt
ttcgtgaacaagcaacaggcccatgacctactcattaacaagcctgatgggaccttcttg
ctgagattcagcgactctgaaatcggtggcatcaccattgcttggaagtttgattctcag
gaaagaatgttttggaatctgatgccttttaccaccagagacttctccatccggtccctg
gctgaccgcttaggggacctgaattaccttatctacgtgtttcctgatcggccaaaagat
gaagtgtactccaaatactacacaccagtcccatgcgagcctgccactggcttctcctgt
tcctcctgcaggtttgtgaatgcgtctgcagactctgccggggccagcgccacctacgtg
gaccaggccccctccccagccgtgtgcccccaggctcattataacttgtacccacagaac
cctgaccccgtccttgacaatgatggggactttgatctggatgacacaatggatgtggcg
cggcgtgtggaagagctcttgggccgacctatggacagtcagtggatccctcacgcgcag
tcatga

KEGG   Panthera tigris altaica (Amur tiger): 102972762
Entry
102972762         CDS       T02988                                 

Gene name
STAT5A
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04012  ErbB signaling pathway
ptg04217  Necroptosis
ptg04630  JAK-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04917  Prolactin signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04935  Growth hormone synthesis, secretion and action
ptg05161  Hepatitis B
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05203  Viral carcinogenesis
ptg05220  Chronic myeloid leukemia
ptg05221  Acute myeloid leukemia
ptg05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102972762 (STAT5A)
   04630 JAK-STAT signaling pathway
    102972762 (STAT5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102972762 (STAT5A)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102972762 (STAT5A)
   04659 Th17 cell differentiation
    102972762 (STAT5A)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102972762 (STAT5A)
   04935 Growth hormone synthesis, secretion and action
    102972762 (STAT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102972762 (STAT5A)
   05203 Viral carcinogenesis
    102972762 (STAT5A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102972762 (STAT5A)
   05220 Chronic myeloid leukemia
    102972762 (STAT5A)
   05223 Non-small cell lung cancer
    102972762 (STAT5A)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102972762 (STAT5A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102972762 (STAT5A)
   05161 Hepatitis B
    102972762 (STAT5A)
   05162 Measles
    102972762 (STAT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102972762 (STAT5A)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102972762 (STAT5A)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 102972762
NCBI-ProteinID: XP_015395500
LinkDB
Position
Un
AA seq 802 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAHWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQVGVKAGSSAGKQCLPSLSSLRTPGF
FPGLVTDSPCDPELIGNFSALQFPPPPLSKSDLSNSLTIRQTNNGSSPAGILVDAMSQKH
LQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLNPQERLSRE
TALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQL
AGNGGPPEGSLDVLQSWEWGVGGCNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATV
RLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTL
SAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHG
SQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVF
LAQKLFNSSSSHLEDYNGMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDG
AILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFS
IRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASAD
SAGASATYVDQAPSPAVCPQAHYNLYPQNPDPVLDQDGEFDLDETMDVARHVEELLRRPM
DGLDPRLSPPAGLFTSARGSLS
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggcgggctggatccaagcccagcagctgcagggagatgcgctgcgccagatgcaggtg
ctgtacgggcagcacttccccatcgaggttcggcactacttagcgcattggatcgagagc
cagccgtgggatgccatcgacctggacaatccccaggaccgagcccaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaagtgggggaagatggg
ttcttactgaagatcaagctggggcactatgccacgcagctccaggtgggtgtgaaggct
gggtcatcagcagggaagcagtgtctgccttctctttccagcctcagaacccctgggttt
tttcctggcctggtcactgactcaccatgtgaccctgagctaatcggcaacttttctgct
cttcaatttcccccacctcctctttctaaatcagacctgtcaaattcccttaccatacga
caaaccaacaatggtagttctccagctgggatcctggtggacgccatgtcccagaaacac
ctccagatcaaccagacgtttgaggagctgcgactggtcacacaggacacagagaatgag
ctgaagaagctgcagcagactcaagagtacttcatcatccagtatcaggagagcctgagg
atccaggctcagtttgcccagctggcccagctgaatccgcaggagcgcctgagccgggag
acggccctccagcagaagcaggtgtccctggaggcctggctgcagcgggaggcccagacg
ctgcagcagtaccgtgtggagctggccgagaagcaccagaagaccttgcagctgctgcgg
aagcagcagaccatcattctggatgatgaactgatccagtggaagcggcggcagcagctg
gcggggaacggagggccccccgagggcagcctggatgtgctgcagtcctgggaatggggt
gtgggggggtgcaatgccaccatcacagacatcatctcagccctggtgaccagcacattc
atcatcgagaagcagccccctcaggtcctgaagacccagaccaagtttgcagcgacggtg
cgcctgctggtgggcgggaagctgaacgtgcacatgaaccccccccaggtgaaggccacc
atcatcagtgagcagcaggccaagtcactgctcaagaatgagaatacccgcaacgactac
agtggagagatcctgaacaactgctgtgtgatggaataccaccaagccactggcaccctg
agcgcgcacttcaggaacatgtcactaaagagaattaagcgtgctgaccggaggggcgca
gagtctgtgacggaggagaagttcacagtcctgtttgagtctcagttcagtgtcggcagc
aatgagcttgtgttccaagtaaagactctgtcccttcccgtggttgtcatcgttcatggc
agccaggaccacaacgctaccgccactgtgctgtgggacaacgccttcgctgagccgggc
agggtgccatttgccgtgcccgacaaagtgctgtggccgcagctgtgtgaggcgctcaac
atgaaattcaaggccgaagtgcagagcaaccggggcctgaccaaggagaacctcgtgttc
ctggcacagaaactgttcaacagcagcagcagccaccttgaagactataatggcatgtcc
gtgtcctggtcccagttcaacagggagaacttgccgggctggaactacaccttctggcag
tggttcgatggggtcatggaggtgctgaagaagcatcacaagcctcattggaatgacggg
gccatcctaggttttgtgaataagcaacaggcccatgacctgctcatcaacaaacccgat
ggaacctttttattgcgctttagcgactctgaaatcgggggcatcaccattgcctggaag
tttgactctcctgaccgcaacctttggaacctgaagccgttcaccacgcgggacttctcc
atccggtccctggctgaccggctgggggacctgagctatctcatctatgtatttcccgac
cgacccaaggatgaggtcttctccaagtattacacccctgtgctcgctaaagcggtggac
ggatacgtgaagccacagatcaagcaagtggtccctgagtttgtgaatgcgtctgcagac
tctgccggggccagcgccacctacgtggaccaggccccctccccagccgtgtgcccccag
gctcattataacttgtacccacagaaccctgaccccgtccttgaccaggatggagaattt
gacctggatgagaccatggatgtagccaggcatgtggaggaactcttacgccgcccgatg
gacggtctggacccccgcctctccccgcctgctggtcttttcacctctgcccgaggctcg
ctctcgtga

DBGET integrated database retrieval system