KEGG   Panthera tigris altaica (Amur tiger): 102972788Help
Entry
102972788         CDS       T02988                                 

Gene name
UNG
Definition
(RefSeq) uracil DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03410  Base excision repair
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102972788 (UNG)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102972788 (UNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102972788 (UNG)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     102972788 (UNG)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     102972788 (UNG)
 Prokaryotic type
     102972788 (UNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG Toxin_ToxA PHTB1_C
Motif
Other DBs
NCBI-GeneID: 102972788
NCBI-ProteinID: XP_007092417
LinkDB All DBs
Position
Un
AA seq 281 aa AA seqDB search
RLLTSLRGDRLQASPAKKARGGQEDPGTPPTSPLSPEQLIRIQRNKAAALLRLAARNVPV
GFGESWKKHLSAEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIRHVKVVILG
QDPYHGPNQAHGLCFSVQRPIPPPPSLENIYRELSTDIDGFVHPGHGDLSGWAKQGVLLL
NAVLTVRAHQANSHKERGWEEFTDAVVSWLNHNSSGLVFLLWGSYAQKKGSAIDRKRHHV
LQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKEPINWKDL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
cggctcttgaccagcctgcgcggggatcgcttgcaggccagccctgccaagaaggcccgg
gggggacaggaggaccccggcacgccccccacctcgccgctgagccccgaacagttgatc
cgcatccagaggaacaaggccgccgccctgctcagactcgccgcgcgcaacgtgcccgtg
ggtttcggtgagagttggaagaagcacctcagcgccgagttcgggaaaccgtatttcata
aagctcatgggatttgttgcagaagaaagaaaacattacaccgtgtacccacccccacac
caagtcttcacctggacgcaaatgtgtgacataagacatgtgaaggttgtcatcctggga
caggatccatatcacggacccaatcaagcccacggtctctgctttagtgttcaaagaccc
attccacctccacccagtttggaaaacatttatagagagctgtctacagacatagatggt
tttgttcatcctggtcacggagatttatccgggtgggccaaacaaggtgttctcttactc
aacgcagtcctcaccgtccgggcacatcaggctaattcgcataaggagagaggatgggag
gagtttacggatgcggtcgtgtcctggctaaatcacaactccagcggcctcgtcttcctg
ctctggggctcttacgctcagaagaaaggcagtgccatcgataggaaacgtcaccacgtg
ctgcagaccgctcacccctccccgttgtcggtgtacagagggttctttggatgtagacac
ttctctaaaaccaatgagttgctgcagaagtctggcaaggagcccatcaactggaaggat
ctgtga

DBGET integrated database retrieval system