KEGG   Panthera tigris altaica (Amur tiger): 102972819Help
Entry
102972819         CDS       T02988                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    102972819 (TGM2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102972819 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 102972819
NCBI-ProteinID: XP_015391007
LinkDB All DBs
Position
Un
AA seq 687 aa AA seqDB search
MAEELVLERCDLELEANGRDHHTADLCREKLVVRRGQAFRLTLHFKGRNYEASVDSLTFS
VTTGAAPSKEAGTRARFPLSDAVEEGAWTAKVVDQRDSALSLQLSTPPNAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNPWCAEDSVYLDSDEERQEYILTQHGFIYQGSAKFINNIPW
NFGQFEDGILDICLLLLDKNPKFLKDAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMFWIGSVDILRRWKSSGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMSRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQEDGSMHKSINHSL
VVGLKISTKSVGRDQRQDITDTYKYPEGSPEEREAFKRANHLNKLTNKENTGMAMRIRVS
QSMSMGSDFDVFAYITNNTSEEHTCRLLLCARTVSYNGILGPECGTKDLLNLSLAPFSEK
SIPLRILYEKYCDCLTESNLIKVRGLLTEPAVNSYLLAERDIYLENPEIKIRILGEPKQK
RKLVAEVSLRNPLTTPLSNCIFTVEGAGLTEEQKVVEIPDPVEAGEEAKVRVDLLPLHVG
RHKLVVNFESDKLKAVKGFRNVIVGPA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaactggttctggagagatgtgacctggagctggaggccaatggccgtgac
caccacacagccgacctgtgccgggagaagctggtggtgcggcgggggcaggccttccgg
ctgacactgcatttcaagggccgaaactatgaggccagtgtggacagcctcaccttcagt
gtcacgaccggtgcagcacccagcaaggaggccggcacccgggcccgtttcccgctgtcc
gatgccgtggaggaaggtgcctggacggccaaggtggtggaccagcgggacagtgccctc
tcgctgcagctcagcaccccgcctaacgcccccatcggcctgtaccgcctcagcctggag
gcctccaccggctaccagggctccagcttcgtgctgggccacttcatcctgctcttcaac
ccctggtgcgcagaggattctgtgtacctggactcggatgaggagcggcaggagtacatc
ctcacccagcatggcttcatctaccagggctcggccaagttcatcaacaacataccctgg
aactttgggcagtttgaagacgggatcctggacatttgcttgctgctcctggacaagaac
cccaagttcctgaaggatgccggccgcgactgctcccgccgcagcagtcccgtctacgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctggggcgc
tgggacaacaactacggggacggcatcagccccatgttctggatcggcagtgtggacatt
ctgcggcgctggaagagctccggctgccagcgtgtcaagtacggccagtgctgggtcttc
gcggctgtggcctgcacggtgctgcggtgcctcggcatccccacccgagtggtgaccaac
tataactcggcccacgaccagaacagcaacctgctcatcgagtacttccgcaacgagttt
ggggagatccagggtgacaagagcgagatgatctggaacttccactgctgggtggagtca
tggatgagcaggccagacctgcagccgggctacgaggggtggcaggccctcgaccccacg
ccccaggagaagagcgaagggacatactgctgtgggcccgttccagtgcgtgccatcaag
gagggcgacctgagcaccaagtacgacgcgccttttgtctttgctgaggtcaatgccgac
gtggtggactggatccggcaggaagatgggtccatgcacaagtccatcaaccactccctg
gtcgtggggctgaagatcagcactaagagcgtgggccgtgaccagcggcaggacatcacc
gacacctacaagtacccggaggggtcgccagaggagagagaggccttcaagagggccaac
cacctgaacaagctgactaataaagagaacaccgggatggccatgcggatccgcgtgagt
cagagcatgagtatgggtagcgacttcgacgtcttcgcctacatcaccaacaacacctcc
gaggagcacacctgccgcctcctgctctgtgcccgcaccgtcagctacaacgggatcctg
gggcccgagtgcggcaccaaggacctgctcaacctctccctggcgcctttctccgagaag
agcattccccttcgaattctctacgagaaatactgtgactgcctgaccgagtcaaacctc
atcaaggtgcggggactcctcactgagccggctgtcaacagctacctgctagctgagagg
gacatctacctggagaatccagaaatcaagatccggatcctgggcgagcccaagcagaaa
cgcaagctggtggctgaggtgtccctgcggaacccgctcaccacgcccctgtcaaactgt
atcttcaccgtggagggggccggcctgaccgaggagcagaaggtcgtggagatcccggac
cccgtggaggcgggggaggaagccaaggtgagggtggacctgctgccactccacgtgggc
cgccacaagctcgtggtgaactttgagagcgacaagctgaaggccgtgaaaggcttcagg
aacgtcatcgttggtcccgcctag

DBGET integrated database retrieval system