KEGG   Panthera tigris altaica (Amur tiger): 107180157
Entry
107180157         CDS       T02988                                 

Definition
(RefSeq) uncharacterized LOC107180157
  KO
K04736  interleukin 3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04664  Fc epsilon RI signaling pathway
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05221  Acute myeloid leukemia
ptg05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107180157
   04151 PI3K-Akt signaling pathway
    107180157
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107180157
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107180157
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107180157
   04664 Fc epsilon RI signaling pathway
    107180157
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107180157
   05202 Transcriptional misregulation in cancer
    107180157
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    107180157
  09163 Immune disease
   05310 Asthma
    107180157
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    107180157
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    107180157
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   107180157
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Haparin
  Cytokines
   107180157
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 107180157
NCBI-ProteinID: XP_015395531
LinkDB
Position
Un
AA seq 244 aa
MKEQVCSVYGPTGSFSNLEAACAEDRSAYDIKAEAVTQADIPRLHRMESGSDNIERAEIQ
ANVLVEYLGICTQLSYLPSSGADESNYRDVDGLQRLLLAWSLPKSLHSGTSGTPGQDSCK
YWDSISEIYYKLNTTSTPEEFNLLLELKDKTLLKSNLAAFRTISEKFINVSNVVSSISKN
LDYLEELLQTLTMPTPTSQREVHIEAEDFNEFSEKLLVFLEALDDFLKPLLKCPETFKAS
RRKP
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaaggagcaggtttgcagtgtctatggacctacaggaagtttcagcaatttggaggct
gcttgtgcagaagacagatctgcctatgacatcaaggctgaggccgtgacacaggcagac
attcctagattgcaccgcatggaaagtggcagcgataacatcgagcgggctgaaatccag
gccaatgtgctggttgagtacctggggatctgtacccagctctcatacctgccttcctct
ggggctgacgagagtaattaccgggatgtggacggcctccagagacttctcctggcgtgg
agcctccccaagtccctgcactcagggacctctggtaccccaggtcaggactcctgcaag
tactgggacagcatctctgaaatctactataagctgaacactacctctacacctgaagag
tttaatctgctgctagagctgaaggacaagacccttctgaagtctaacctggctgccttc
cggaccatctcagagaagttcatcaatgtctctaatgtagtgtcatccatcagtaaaaat
ctggactacctggaggaattgctgcaaaccttgaccatgcccacgcccacatcccagaga
gaagtgcatatcgaagcagaagattttaatgagttctcagagaagctgcttgtcttcctg
gaagccctggatgatttcctgaagccattactgaagtgcccagaaactttcaaagcctca
cgtagaaaaccttag

DBGET integrated database retrieval system