KEGG   Pelotomaculum thermopropionicum: PTH_0142Help
Entry
PTH_0142          CDS       T00519                                 

Definition
(GenBank) hypothetical protein
Organism
pth  Pelotomaculum thermopropionicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 Pkinase HATPase_c Response_reg Pkinase_Tyr HisKA GAF_2 GAF Hpt APH GAF_3 AAA_22 Kdo ATPase_2 Cas_Cas02710 AAA Kinase-like DnaB_C AAA_18 NACHT DUF2791 NB-ARC TsaE Zeta_toxin Wtap GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: BAF58323
UniProt: A5D5Z4
LinkDB All DBs
Position
129193..135408
Genome map
AA seq 2071 aa AA seqDB search
MFIASNYRIIEQLHKKNSVVYRARRNADGRPVILKILNRRYPPPEEAARFKREYEIIRGL
PVEGVVEAYAFEKDQGYLIMVLEDFGGTSLDLLLPSMKMDLNTFLSLAVKVAGTLDMIHR
QGVVHRDINPSHIVWNPETGRVKIIDFGLAAVLPGDSREVYTAGLLEGTLAYMSPEQTGR
MNRAVDYRTDLYSLGVTLYETATNRLPFVAGDALEMVHSHIARAPVPPHEVNPEIPEMVS
RIILKLMAKTAEERYQSAAGLQADLQRCLDRYEATGRVDVFEAGCRDLSGRLKVPQKLYG
REKEMKELLAGLDRAGTGLAEMILVAGRAGVGKTALVQEMLKCVGRKRGYFISGKFEQFR
HNVPYASLVQALQKLVRQILAESEERIASWREKLLKALGPNGQIIIELIPELELITGPQP
PARDLPPGESQNRFRLVFQNFLRTFAAGEHPLVIFFDDLQWADAASLQQLKHLVSGAEMK
HLLLIGAYRDNEVADGHPLPQVIEEIKSAGTAVRLIGLGPIDPAATGRMLAEALGCEEAA
ARPLAGLVYRKSAGNPFYARQFLQKIYEEGLLFFDRREHCWKWDAGRVLQLETGDGVIDL
LIGRIRKLPEKTREVLKVSACIGRAFDLKTLTVVCGQSPGRTAEDLLPALRAGVVVAGGG
FSPADGAAREPDEHAGPEGPFAFCEFAHDRVQQAVYSLLSGAEKKAIHRRVGLALLRETE
PEHLERKIFEIADHLNNGRELIAGRDESLRLAAYNLSAARKAKLSVAFEAALHYLEAGRS
CLPEGAWKDCYRLAFDLHLELCQCLYLCRKEEAAEQVFRMLLDRAGTRADRSQVFAMKAV
ICTETIRYPEAVRFGLMGLKELGFFLPERPGNYFLLKESLGVRWRLALKKNKALPELPQI
KNPRLEKIMDQMAGLLPVTSLTNPRLFTALILKMLKISLKHGNTRHSTIVYACYGLISAI
RGNMRIAGEMQEVSLMLTGRYGDHPVKSPVYYSVASFLSHWTEPLQKTLQHAAAAHQCAL
EFGNFFYAGADLARITEIRLILGEPLPRVYEECASSLEFTRRFKLENLARFFAMARMFIE
DMQETSPFFFAADEAERLGEQVKANRNGPMIINYYLLKIQSLYHHGRYAEALDVFREIDK
NSVSSVLAMVIFTEYVFWHSLVITAAYGQLVEEQKGRCRKILRENRRKLKKWADSCPRNF
LQKYCLVAAETARLAGRPAEAMELYDRAIFWAKENEFVRDEALGNELAARFWLAAGKADI
AALYAGRALRGYRYWGAKRKVRRLSEEFSHLSAHPEAGLIPVLDKMQAIVSAESARAAAS
ELDLASIIKLSQVLSGEIVLPELLKKTMRIILENAGAQRGFFIAESGGELRIEAEAHAGG
GGAAGSLQPSGGEGAPQEQQVFLQSVPLAGAKHLSAAVVQYVARTGEYVVLHDAAQEGAF
ARDEYIQKNSPKSVICLPVTGKGKPAGILYLENNLSAATFTPDRVEVLRLLSTQIAISIE
NARLYASLEESRNQIAGWSQFLEQTVAARTRELQETNELLKQAKEAADAANRAKGKFLAV
MSHEIRTTLNGLIGMAELLLDTPLNGEQQEYVSAVRECADSLLSVVNDLLDFSRIEEGRL
VLETVSFNPASLVEKSVALVEPGARQKSLLLKYHIAPDVPGTLQGDPIRLRQVLLNLLGN
AVKFTERGEISLSAFVEGREPDSLTVRFEVQDTGIGIPEEARSMLFRPFTQAGPSSAGRY
GGAGLGLSICKRLVELMGGRIGFESEEGRGSTFWFSVPFAAGKSMDAPSGASPAPVRPLT
PKWQPGPILVAEDFAINQKLIQAQLRKLGLAADVAGNGREAVEAFSRNSYALVLMDCRMP
VMDGFEATRAIRSLEALRGRRTPIIATTAAAMPGEREKCLSAGMDDYLTKPVRMEDLQRV
LSRWLPAPELPLAGESGNLPRPGKEALQLPGLTAVNGDRLGELLNTTGEDVHFLCRLIRA
FLRDMPEKLKSLRSALRQGDAATARLQAHGMKSSSSILGAALFADLCREAEELAAGGVTG
GADKLVARLEAEYERVVKDFETILESQLPLR
NT seq 6216 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgcctcaaattaccggattatagaacaactccacaaaaaaaactcggtcgtc
taccgtgcccgccgtaatgcagacggccggcccgtcattctcaaaatactgaacaggcga
tatccgccacccgaggaagccgcccgcttcaaacgggagtacgaaattatccgcggcctg
cccgtggaaggggttgttgaggcgtatgcctttgaaaaggaccagggttaccttattatg
gttctggaagatttcgggggtacgtcgctggaccttttactgccgtccatgaaaatggat
ttgaacacattcctgtctcttgccgttaaggtggccgggacactggacatgattcaccgg
cagggggtcgtccacagagacatcaacccgtcccacatcgtctggaacccggaaaccggc
cgggtcaaaatcatcgacttcggcctggccgcggttttaccgggcgatagccgggaggtt
tacaccgccggccttctggaaggaacgctggcctacatgtccccggaacagacgggcaga
atgaaccgggccgtggattaccggaccgacctgtattcgctgggcgtgacgctgtacgag
acggcgactaacaggctgccctttgtagccggtgacgccctggaaatggtgcattcgcac
attgccagggcacctgtaccgccgcatgaggttaatccggaaataccggaaatggtttcc
agaatcattttgaagctaatggccaaaacagcggaagaacggtaccagagcgccgccggc
ctccaggccgatttgcagaggtgcctggaccggtacgaagcgacgggcagggtggatgtc
tttgaagccggctgccgggacctctccggcaggctgaaagtgccccagaagctgtacggc
cgggaaaaggaaatgaaagaactgctggccggtctggaccgggccggcaccggtttggcg
gaaatgatcctggttgcgggccgcgcaggtgtgggcaaaaccgcgctggttcaggaaatg
ctcaagtgcgtggggcgaaagcgcggctacttcatttccggcaaattcgagcagttcagg
cacaacgtcccctacgcctccctggttcaggccctgcagaaactggtccggcaaatcctg
gccgaaagtgaagagcggattgcctcctggagggagaaactgctcaaagccctggggccg
aacggacagatcatcatcgagcttattccggagctggagctgatcaccggcccgcagccg
ccggcccgggatctgccccccggcgagtcgcaaaaccgcttccgcctcgtatttcagaat
tttttacgcacatttgccgccggggaacaccccctggtcatttttttcgacgacctgcag
tgggccgacgccgcttccctgcagcagttgaagcacctggtaagcggtgcggagatgaaa
cacctcctgctcatcggggcctaccgggataatgaagtggcggacggccacccgctgccg
caggtgattgaagaaattaaaagtgccgggacggccgtccggctgatcggcctggggccc
attgatccagccgccaccgggcggatgctggcggaggccctgggctgcgaggaggccgcc
gcccggcccctggccggactggtttaccggaaatcggcgggcaaccctttttacgccagg
caattcctgcaaaagatttatgaagagggtcttttgtttttcgaccggcgggaacactgc
tggaagtgggacgccggacgcgtcctgcaactggaaaccggggacggcgtgatcgacctg
ctaattggcagaatccggaaactgcctgaaaagacaagggaggtattgaaggtctcggcc
tgcattggaagggcattcgacctgaaaaccctgaccgttgtctgtggacaatcccccggc
cgcacggcggaagacctgttgccggccctccgggcaggcgtggtcgttgccgggggcggt
ttttcccctgcagacggtgccgcccgggaaccggacgaacatgccgggccggaggggcct
ttcgctttttgcgaattcgcgcacgaccgcgtccagcaggcggtttattcccttctgtcc
ggtgcggaaaagaaagctatccaccgccgggttggcctggcgcttctccgggaaacggag
ccggagcatttggagaggaaaatttttgagatcgccgaccacctgaacaacggccgggaa
ttaattgcaggccgggatgaaagcctcaggctggccgcatacaacctgtcggccgcccgc
aaggcaaagctttcggttgccttcgaggcagctctccactatctggaggcgggccggagc
tgtttgcccgaaggcgcctggaaagattgttaccgcctggccttcgacctgcacctggaa
ctttgccagtgcctttacctgtgcagaaaagaggaggccgcggagcaggtgttccggatg
ctgctggacagggccggaacgcgggcggaccggtcgcaggtttttgccatgaaggccgtt
atctgcacggaaacgatccggtatcccgaggcggtccggttcgggctgatgggtttgaag
gaactgggctttttcctccccgaaaggccgggaaattatttcctgttgaaagagagcctg
ggggtcaggtggcgcctggccctgaagaaaaataaggcgctgcccgagctgccccagata
aaaaacccgcgcctggagaaaatcatggatcagatggccggcctgctgccggtcaccagc
ctgaccaatccccggctgtttaccgccctgatcctgaaaatgctcaagatctccttgaaa
cacggcaacaccaggcactccaccatcgtctacgcctgctacggcctgatcagcgccatc
cggggcaacatgaggattgccggggaaatgcaggaggtttcgctgatgctgaccggccgg
tacggcgaccatcccgtcaagagcccggtttattacagcgtggcctccttcctcagccac
tggacggaacccctgcaaaaaaccctgcagcacgcggctgcggcccatcaatgcgccctc
gagttcggcaactttttctatgctggcgccgacctggcccgcattaccgaaatcaggctc
attttgggcgagcccctgccccgggtttacgaggaatgcgcctccagcctggagtttacc
agacggttcaagctggagaacctggcgcggttttttgcgatggcccgcatgtttatagaa
gacatgcaggagacctctccatttttcttcgccgcagacgaagcggaaaggctgggggag
caggtgaaggcaaacaggaacggcccgatgattatcaattattacctgctcaaaatccag
tccttgtaccatcacggccgctacgccgaggccctggacgtgttccgggaaatcgacaag
aacagcgttagttcggttttggccatggtcatctttaccgaatacgtcttctggcactcc
ctggtcatcaccgccgcctacggacaactggtggaggagcagaagggacgctgccggaaa
attctccgggaaaaccggcgcaaactgaaaaaatgggccgattcctgcccccgcaatttc
ctgcaaaagtactgcctggttgcggcggaaacggcccgcctggccggccggccggccgaa
gccatggaactgtacgaccgcgccattttctgggcgaaggaaaacgagtttgtgcgggac
gaggccctgggcaacgaactggcggccagattctggctggccgcaggaaaggcggacata
gccgcgctgtacgcgggaagggcgttacggggctatcggtactggggggcgaaacgcaaa
gtacgccgcctgtcggaagaattctctcacctgtctgcccatccggaagcggggctgata
ccggttctcgacaaaatgcaggccattgtttcggcggaatccgccagggccgccgccagc
gagctggacctcgcctcaatcattaagctttcgcaggtgctttccggggagatcgtgctg
cccgagttgctgaaaaaaacaatgcggatcatcctggagaatgccggggcgcagcggggc
tttttcattgcggagtccggcggggagttgaggatagaagcggaggcccatgcgggcggc
gggggcgcggccgggagcctgcagccgtcaggcggggaaggcgcgccgcaggagcagcag
gtcttcctgcaatccgtccctctggcgggggcaaagcacctgtccgcggccgtagtgcaa
tatgtggccagaaccggggaatacgtggtgctgcacgacgcggcgcaggagggggcgttt
gcccgcgatgagtacatccagaaaaacagcccgaaatctgtcatctgcctgccggtaacc
ggaaaggggaagccggccggtatcctctatctggagaacaacctgtctgcggcaacattc
accccggaccgggtggaagtgttgaggcttttgtctacccagattgccatttccatcgaa
aacgcccgcctttatgccagcctggaggagtcgagaaaccagatcgccgggtggagccag
ttcctggaacagacggtggccgcaagaacgcgcgaactgcaagaaaccaacgaattgctg
aagcaggcgaaagaggctgccgacgcggccaaccgcgccaaaggcaagttcctggcagta
atgagccatgaaatccgcacgaccttgaacggcctgatcggcatggccgaactgctgctg
gacacccccttaaacggcgagcagcaggagtacgtgtccgccgtgcgggagtgcgcggac
tcccttttgtcggtagtcaacgacctcctggacttttccagaattgaagaaggcaggctg
gtcctggaaacggtcagcttcaacccggcttcactggttgaaaaaagcgttgccctggtg
gagcccggggccaggcaaaaaagccttctcctcaagtatcatatcgccccggacgttcca
ggaaccctgcagggcgacccgatccgcctgcgccaggtgctgctaaaccttttaggcaac
gccgttaagtttacagaaaggggcgaaatttccctcagtgcctttgtggaagggagggag
ccggattccctaaccgtgcgcttcgaggtgcaggacacgggcatcggcattccggaggaa
gccaggagcatgcttttccggccgttcacccaggccggcccttcttcggccggcaggtac
ggcggagccggcctgggcctgtccatctgcaagcggctggtggaactgatgggcgggcgg
atcggcttcgagagcgaggaaggccggggctccaccttctggtttagcgtcccctttgct
gccggcaagtccatggatgccccttccggcgcgtcccccgcccctgtccggcccctgacg
ccgaagtggcagcccggcccgatcctggtggccgaagacttcgccatcaaccagaaactt
attcaggctcaattaaggaaactgggcctggccgccgatgtggcaggcaacgggagggag
gcggtggaggccttctcccggaactcttacgccctggttttaatggactgccggatgccg
gtgatggacgggtttgaggcgaccagggcaatccgcagcctggaggctttgcgcgggcgg
cgcacccccattattgccaccacggctgctgccatgcccggggaacgggagaagtgcctg
agcgccggaatggacgattacctcaccaagccggtgcggatggaagacctgcaaagagtc
ctttcccgctggctgcctgctccggagctgccgctggcaggtgaatcagggaatctcccc
cggccggggaaggaggccttgcagttaccggggctgacggcggtaaacggggacaggttg
ggcgaacttctgaataccacgggagaagacgtgcattttttgtgcagactgatcagagct
tttctgcgggacatgcctgaaaagctaaagtccctccgttcggccctgcggcagggggac
gctgccacggcgcgcctgcaggcccacggcatgaagtccagcagctccatcctgggcgcc
gcgctatttgcggatttgtgcagggaagcagaagagctggccgccggcggtgtcaccggc
ggtgcggacaaactggtggcgcggctcgaagcggaatacgaacgggtggtgaaagacttt
gaaaccattcttgaaagccagttgccgctgcgttga

DBGET integrated database retrieval system