KEGG   Pelotomaculum thermopropionicum: PTH_1131Help
Entry
PTH_1131          CDS       T00519                                 

Gene name
AroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01130  Biosynthesis of antibiotics
pth01230  Biosynthesis of amino acids
Module
pth_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTH_1131 (AroK)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PTH_1131 (AroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 AAA AAA_22 AAA_16 Cytidylate_kin Mg_chelatase AAA_5 PduV-EutP
Motif
Other DBs
NCBI-ProteinID: BAF59312
UniProt: A5D373
LinkDB All DBs
Position
1168510..1169028
Genome map
AA seq 172 aa AA seqDB search
MKNIVLIGFMGTGKTAVGRRLAGRLKREFIDTDAEIEKVTGKTVAQIFARDGQIRFRSEE
ALLVRKLAGKENLVISTGGGMVLNPENVRLLKENGVLIALTADPEVICRRVKNKKNRPLL
MRGDLRENIKALLKEREGVYDVAEHKVDTGSMSLDQAVENIIHFLKEHNYIE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatagtcttaattggcttcatgggtacgggcaagaccgccgtcgggcggcgg
ctggccggccgcctcaagagggagtttatcgataccgacgcggagattgaaaaggttacc
ggaaagaccgtggctcaaatatttgccagggacgggcagatccgcttccgttcggaggaa
gccctgctggtacggaagctggccggaaaggaaaacctggtcatttccacgggcggcggt
atggttttaaatcctgaaaacgtaaggctgcttaaggagaacggcgtactgatagccttg
acggcggacccggaggtaatctgccggcgggtaaagaacaaaaagaaccgtcccctgctg
atgaggggggacctgagagaaaacataaaggcccttttaaaagagcgggagggcgtttat
gacgtggccgagcacaaggtggacaccgggagcatgagcctggaccaggcggtggaaaat
attatccacttcctaaaggagcataattacatcgaatag

DBGET integrated database retrieval system