KEGG   Pelotomaculum thermopropionicum: PTH_1244Help
Entry
PTH_1244          CDS       T00519                                 

Definition
(GenBank) predicted eukaryotic-type DNA primase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pth00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PTH_1244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pth03400]
    PTH_1244
Enzymes [BR:pth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PTH_1244
DNA repair and recombination proteins [BR:pth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PTH_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAF59425
UniProt: A5D2W2
LinkDB All DBs
Position
1283683..1284654
Genome map
AA seq 323 aa AA seqDB search
MERQSLKDLDVTVDGRRLRLTNLNKLMWPEGLTKADLIKYYSAVAPYILLYLANRPLVMK
RYPDGLAGGAFYQKECPAYAPLWIKRQPVRHGGKVVNYIVCNDSATLIWLANQACIEMHA
WPARAENLESPDLAVMDLDPAEGATFTDVLDIALMVRTVLDEFGLKSFPKTSGAGGIHLF
IPVRPCYTWQQVAAAMKCVAGIVEGACPGRATTERKVEKRKGKVYLDYLQNAKGKTMAFQ
YSLRPLPGAPVSAPLLWQEVEKREVRPWQFNIDTIFQRLADRGDLYNGMQGLDQSLDELI
KISTKKIFPAGRKISPQPRKEGD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggaaagacagtccttaaaagatcttgacgttacggtggacggccgcaggctgaggctg
accaacctgaacaagctgatgtggccggaaggcctgaccaaggccgacctgatcaagtat
tattcggccgtggcgccgtacattctgctttatctggccaaccggcctcttgttatgaag
cgctatccggacggcctggcaggcggggcgttctaccagaaggaatgtcctgcctatgct
cctttgtggattaaaaggcagccggtgaggcatggcggaaaagttgtaaattacatagtc
tgcaacgacagcgcaaccctgatctggctggccaaccaggcctgcattgaaatgcacgcc
tggcctgcccgggcggaaaatctggagagcccggacctggccgtaatggatttggacccg
gccgagggtgccacctttaccgacgtgctggatatagcccttatggtcagaacggtgctg
gatgaatttggcctgaaaagctttcccaagacttccggggccggcggaatacacctgttt
atccccgtcaggccttgttatacctggcagcaggttgccgcggcgatgaagtgcgttgcc
ggaatagtggaaggtgcctgcccgggcagggcaacaacagaaagaaaagtcgaaaaaaga
aaaggcaaggtgtaccttgattacctgcagaacgcaaagggaaagacaatggccttccaa
tacagcctgcggcccttgcccggtgctcccgtgtccgccccgctgctctggcaggaggtt
gaaaaaagggaggtcaggccttggcagtttaacattgataccattttccagcgccttgcc
gaccggggcgacctttataacggcatgcaagggctggaccagtcgctggatgaacttata
aaaatatccacaaagaaaattttcccagccggaaggaagatttcccctcaaccccgaaaa
gaaggggattaa

DBGET integrated database retrieval system