KEGG   Pelotomaculum thermopropionicum: PTH_1781Help
Entry
PTH_1781          CDS       T00519                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pth  Pelotomaculum thermopropionicum
Brite
KEGG Orthology (KO) [BR:pth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pth01001]
    PTH_1781
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PTH_1781
Protein kinases [BR:pth01001]
 Serine/threonine kinases: Other
  Bacterial family
   PTH_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo DotU FTA2 YrbL-PhoP_reg Pkinase_fungal PBP_N
Motif
Other DBs
NCBI-ProteinID: BAF59962
UniProt: A5D1B0
LinkDB All DBs
Position
complement(1866662..1868524)
Genome map
AA seq 620 aa AA seqDB search
MIGKLLGNRYEILEQLGGGGMAIIYKGRDTFLNRLVTVKVLRPEFTCDEDFVRRFRREAQ
AVASLSHPNIVSIYDVGREDKTHYLVMEYVEGDNLKNLIRGQGRLQPGRAVEIARQISEA
LQHAHENQIVHRDVKPQNILITRWGRAKLTDFGIAREATAATLTQTDTVLGSVHYLSPEQ
ARGETAGPQSDIYSLGVVLYEMVTGVLPFQGETPIAVALKHIQEEPARPSFVNPSVPPGL
EKIICRAMAKVPHERYQSAGDMAADLESLYATVAGEINRAVPVDEFATRVISPVRPAEEE
IKTQAGGRRVKRRRPGWLWAALIVLCLVGVSLAAFQYYVNVPETTVPDVEGMTLEEAQGI
LQKQGFKNIQVTRSYHPSVPQGRVISQDPPPETKVKVTRTIALSVSQGPEYRTVPDVIGL
QLKDARIKISQSELNVADVQERFSDRLQGEVLDQDPKPGARLSKGSGVILYVSKGQQPVT
CQVPDLTGLTLDRARAELERVKLKLDENVGRATSTDYLPGQVISQNPAKGMEVQEGSSVQ
VTISNGPGPARRLARVEAKIPDDKKEHELRIVVKDVQGSSEAYINTHPPGETVIKEVPYY
GKAVIQVYIDKKLVGEKSVE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttgattggaaaactgttgggtaaccgttatgaaatactggaacagctaggcggcggtggc
atggccattatttacaaagggcgagacacctttttaaaccggctggtcactgtcaaggtt
ctccgccccgagtttacctgcgatgaagatttcgtcaggcgctttcgcagggaggcccag
gccgttgccagcctctcccatcccaatattgtcagcatttacgacgttgggcgggaagat
aaaacccattacctggtgatggagtatgtagaaggggacaatttgaaaaacttgatcagg
gggcaggggcgcctgcagcccgggcgggccgtagaaattgcccgccagatcagcgaggcg
ctgcagcatgctcatgaaaaccagattgtgcaccgcgacgtcaaaccgcaaaatattctg
attaccaggtgggggcgggcgaagcttaccgattttggaattgccagggaagcaacggcg
gctactcttacccaaaccgatacggtgcttggatcggtgcactacctttctcccgagcag
gcgcggggtgaaaccgccgggccgcagtcggatatttattccctgggtgttgtactgtac
gaaatggtaacaggagtactgcccttccagggagaaacccccatcgcagtggccttaaag
cacatccaggaggaaccggcccgtccctcctttgtgaacccgtcggtgccacccggcctg
gaaaagattatctgccgggccatggccaaggtgccgcatgagcgttaccagagcgccggg
gatatggcggcggatctcgaatctctgtacgccacagtggcgggggagattaacagggcc
gttccagttgacgagtttgcaaccagggtaatttcccccgtcaggccggctgaggaggaa
ataaagacacaagccggaggaagaagggtaaaaaggcgccggccgggctggctgtgggcg
gcactgatagttttgtgccttgtgggcgtaagcctggcagccttccagtactacgtcaat
gtgcccgaaacaaccgtgccggacgtagaaggaatgactttggaagaggcgcaaggaatt
cttcaaaagcaaggctttaaaaacatccaggtgaccaggagctatcacccgagcgttcct
cagggccgggtgatttcccaggaccctcctcccgagaccaaagttaaggttacccgcacc
attgccctttccgtcagccaggggccggaataccgcaccgtgccggatgtaattggcttg
cagcttaaagatgccaggataaaaataagccagagcgagttaaacgtggccgatgttcag
gaaaggttcagcgaccggttgcagggggaggtgctggatcaggatcccaagcccggggcc
aggctttcaaagggttccggagtgattttgtacgtcagcaagggacagcagcctgtaacc
tgccaggtgccggacctgactggcctgaccctggacagggccagggcagaactggaaaga
gtaaaactgaagctggatgagaacgtgggcagggccaccagtaccgattacctgcccggg
caggtaatcagccagaacccggccaagggaatggaagtgcaggaaggttcctcggtacag
gtgaccatcagcaacggccccggaccggcaaggcgcctggccagggttgaggcaaagatc
ccggatgataaaaaagagcatgagctgagaatagtggtcaaagatgtccagggaagcagc
gaagcttacatcaacacccatccgccgggtgagacggtgattaaggaagtgccctattac
ggtaaagcggtaatacaggtatatatagacaaaaaactggttggtgagaaatccgttgaa
tag

DBGET integrated database retrieval system