KEGG   Pelotomaculum thermopropionicum: PTH_2215Help
Entry
PTH_2215          CDS       T00519                                 

Gene name
PfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00010  Glycolysis / Gluconeogenesis
pth00030  Pentose phosphate pathway
pth00051  Fructose and mannose metabolism
pth00052  Galactose metabolism
pth00680  Methane metabolism
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01120  Microbial metabolism in diverse environments
pth01130  Biosynthesis of antibiotics
pth01200  Carbon metabolism
pth01230  Biosynthesis of amino acids
pth03018  RNA degradation
Module
pth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_2215 (PfkA)
   00030 Pentose phosphate pathway
    PTH_2215 (PfkA)
   00051 Fructose and mannose metabolism
    PTH_2215 (PfkA)
   00052 Galactose metabolism
    PTH_2215 (PfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    PTH_2215 (PfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PTH_2215 (PfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pth01009]
    PTH_2215 (PfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pth03019]
    PTH_2215 (PfkA)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTH_2215 (PfkA)
Protein phosphatases and associated proteins [BR:pth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTH_2215 (PfkA)
Messenger RNA biogenesis [BR:pth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PTH_2215 (PfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAF60396
UniProt: A5D052
LinkDB All DBs
Position
complement(2319742..2320707)
Genome map
AA seq 321 aa AA seqDB search
MLQRIGVLTSGGDSPGMNACIRAVVRKAVYHGLEVMGIKRGFNGFIEGDMVPLHLGSVAD
IIHRGGTILHTARSVQFLNPEGRARANENVKRFGIQGLVVIGGDGSFRGASIFNREYGLP
VVGVPGTIDNDIPGTDQTIGFDTAVNTAVEAINKIRDTATSHERTFVIEVMGRNFGFIAL
AAGLAGGAETILIPERPFSYDEICERLMRGYRRGKLHSIIVVAEGAAGGLEVARKIKERT
GFDTKVTILGHLQRGGTPTAADRILASCLGAKAVELLMAGETRKMVGIKAGKVVALDIED
ALSQTRSIDLDMYSLAGILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcagagaattggagtattgaccagcggcggggattcgccgggcatgaacgcctgc
atcagggcggtggtgcgcaaggccgtttatcacggccttgaggttatgggcataaagcgc
ggctttaacggctttatcgagggcgatatggtaccgctgcacctgggttcggtggcagac
atcatccacaggggcggcaccattctgcacacggcccgctcggttcagtttttgaacccc
gaaggccgggccagggccaatgaaaatgtgaagcgcttcggtattcaggggctggtggtg
atcgggggggatggttccttccggggggccagcatttttaaccgggagtacggcctgccg
gtagtgggggtgccgggcaccatagacaacgatatcccgggcaccgaccagaccatcggc
tttgacactgccgtcaacactgccgtcgaggcaataaacaagatcagggacacggccact
tcccacgaaaggacctttgtcatagaagtaatgggcaggaatttcggctttatcgccctt
gctgccgggctggccggaggggcggagaccatcctgatcccggagaggcctttcagctac
gatgaaatttgcgagcggctgatgcggggttatcgccgcggaaagctgcacagcatcatt
gtggtggccgaaggcgccgccggcggcctggaagtggcccggaaaatcaaggagcgcacc
ggctttgatacaaaagttaccattcttggccacctgcagcggggcggcacgcctaccgca
gccgacagaatcctggccagttgcctgggcgccaaggcggttgagctgcttatggccggg
gaaaccagaaaaatggtgggaataaaagcgggaaaagttgttgccctggatatcgaggat
gccttgagccagaccaggtccatcgacctggacatgtacagcctggcaggcatcctgtcc
atttag

DBGET integrated database retrieval system