KEGG   Pelotomaculum thermopropionicum: PTH_2273Help
Entry
PTH_2273          CDS       T00519                                 

Gene name
RsbW
Definition
(GenBank) anti-sigma regulatory factor
  KO
K04757  serine/threonine-protein kinase RsbW [EC:2.7.11.1]
Organism
pth  Pelotomaculum thermopropionicum
Brite
KEGG Orthology (KO) [BR:pth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pth01001]
    PTH_2273 (RsbW)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:pth03021]
    PTH_2273 (RsbW)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PTH_2273 (RsbW)
Protein kinases [BR:pth01001]
 Serine/threonine kinases: Other
  Bacterial family
   PTH_2273 (RsbW)
Transcription machinery [BR:pth03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     PTH_2273 (RsbW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c_2 HATPase_c Flagellar_put
Motif
Other DBs
NCBI-ProteinID: BAF60454
UniProt: A5CZZ1
LinkDB All DBs
Position
complement(2376510..2376953)
Genome map
AA seq 147 aa AA seqDB search
MALERMAGTLDEETRIELKNSLSELERLSLALEEFGDRRCLPLKTVMDVNLALDEIFTNI
VSYGFPDSDDHLIKINLLIEGKELNITVEDDGMPFNPLEIPEPDLNVPLEERKTGGLGIY
FVRKMVDELRYERRQGKNVLFLKKKII
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
ttggctttggagaggatggcaggaaccttggacgaagaaacgcggattgaactgaagaac
agcctttctgaactggagcggttgagcctggctctggaggaattcggggaccgccgctgc
ctgccgctgaaaaccgtcatggacgtaaacctggccctggatgagatttttaccaacatt
gtatcctatggttttccggatagtgacgatcacctgatcaaaatcaacctgttaattgaa
gggaaagagctgaacattacagtggaggatgacggcatgccctttaatcccctggaaatt
cccgaaccggatctgaacgtgcctttggaagagagaaaaacaggcggactgggcatttat
tttgtccggaaaatggttgacgagctgagatatgaaagaaggcaggggaaaaatgtattg
tttttgaaaaagaaaataatttaa

DBGET integrated database retrieval system