KEGG   Pelotomaculum thermopropionicum: PTH_2521Help
Entry
PTH_2521          CDS       T00519                                 

Gene name
GatB
Definition
(GenBank) asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00970  Aminoacyl-tRNA biosynthesis
pth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PTH_2521 (GatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pth03029]
    PTH_2521 (GatB)
Enzymes [BR:pth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PTH_2521 (GatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PTH_2521 (GatB)
Mitochondrial biogenesis [BR:pth03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PTH_2521 (GatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAF60702
UniProt: A5CZ96
LinkDB All DBs
Position
complement(2625626..2627062)
Genome map
AA seq 478 aa AA seqDB search
MAQYEAVIGLEVHVELKTRSKIFCDSTTEFGGDPNTHVCPVCLGLPGVLPVVNKKVVEYA
IRAALALNCQIAGFSKFDRKNYYYPDMPKNYQISQYDLPIARNGYIEIDVNGKRKRIGIT
RLHMEEDTGKLVHQGTITTTPFSLVDYNRAGVPLIEIVSEPDLRSPEEARQYMEKLRAVI
QYTGVSDCKMEEGSLRCDANVSVRPAGSIAFGTKTEIKNLNSFKALQRALAYEIERQIDV
LEEGGRVVQETRTWDEGKGITLPMRTKEEAHDYRYFPDPDLVPLVIDREWVEDIRRSLPE
LPDEKRERYMREYALPAYDAGVLTSTRELAGFFEACVQGYPNPKIVSNWIMGDLLRLLNA
GNIEIQDCPVKPGQLVSMLRLIEKGTISGKIAKTVFEEMFATGRDAEDIVKEKGLVQISD
EGAIAAIVDQVIAGNPRTVEDYRSGKEKALGFLVGQVMKATRGKANPELVNRLLKEKI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttggctcagtacgaagccgtgatcggcctggaggtgcacgtggagctcaagaccaggtcg
aaaatattctgcgattcgaccaccgaattcggcggcgaccccaatactcatgtctgcccg
gtctgcctgggcctgcccggggtgcttccggtagtcaacaaaaaggtggtggagtacgcc
atccgcgccgccctggccttaaactgccagatagccggtttttccaagttcgaccggaaa
aattactattaccccgacatgcccaagaactaccagatttctcagtacgacctgcccatt
gccagaaacggctacattgaaatagatgtaaacgggaagagaaagaggattggcatcacc
cgcctgcatatggaggaagataccgggaagctggtgcaccaggggaccattaccaccact
cccttttccctggtggactacaaccgggccggggtgcccctgatcgagatcgtttccgag
cccgacctccgctcgccggaggaggcgcgccagtacatggagaagctcagggcggttatc
cagtataccggcgtttctgactgcaaaatggaagaggggagcctgcgctgcgatgccaac
gtttccgtccgcccggcgggaagcatcgccttcgggaccaagacggaaattaagaacctg
aactctttcaaggccctccagagggcgcttgcatacgagatagagcgccagatcgatgtg
ctggaggaaggcggccgggttgtccaggaaaccaggacctgggacgagggcaaggggata
acccttcccatgcggactaaagaggaggcgcatgattaccgctactttcccgaccccgac
ctggttccgctggttatcgaccgggaatgggtggaggacatccgccgctccctgccggaa
ctgcccgatgaaaaaagggagcgttatatgagggaatacgccctgccggcctacgacgcc
ggagtgcttaccagcaccagggaactggccggcttttttgaagcctgcgtgcagggctat
cccaacccgaaaattgtcagcaactggatcatgggcgaccttttaaggctgttaaacgcc
ggcaatatagaaattcaggactgcccggttaaaccgggccagctggtctcaatgctccgg
ctgatcgaaaagggaaccatcagcggcaagattgccaaaacggttttcgaggagatgttt
gccaccggcagggacgcagaggacatagtgaaagagaaaggccttgtccaaattagcgac
gaaggcgccattgccgccatagtagatcaggtgatagcgggcaaccccaggacggtagag
gattaccgctccggaaaagaaaaggcgcttggcttcctggtggggcaggtaatgaaggct
accaggggaaaggccaacccggaactggtaaacaggctgctaaaagaaaagatttaa

DBGET integrated database retrieval system