KEGG   Phaeodactylum tricornutum: PHATRDRAFT_37287Help
Entry
PHATRDRAFT_37287  CDS       T01075                                 

Gene name
MRE11, Mer11
Definition
(RefSeq) Mre11 DNA repair/recombination protein
  KO
K10865  double-strand break repair protein MRE11
Organism
pti  Phaeodactylum tricornutum
Pathway
pti03440  Homologous recombination
pti03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PHATRDRAFT_37287 (MRE11)
   03450 Non-homologous end-joining
    PHATRDRAFT_37287 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pti03032]
    PHATRDRAFT_37287 (MRE11)
   03400 DNA repair and recombination proteins [BR:pti03400]
    PHATRDRAFT_37287 (MRE11)
DNA replication proteins [BR:pti03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     PHATRDRAFT_37287 (MRE11)
DNA repair and recombination proteins [BR:pti03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     PHATRDRAFT_37287 (MRE11)
    BRCA1-C complex
     PHATRDRAFT_37287 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     PHATRDRAFT_37287 (MRE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 7201940
NCBI-ProteinID: XP_002181412
JGI: 37287
UniProt: B7G2N5
LinkDB All DBs
Position
12
AA seq 806 aa AA seqDB search
MSDLAPNDARGEETAQSVAPSDVLEDPDEHTLRMMLSTDNHLGYAEKDPVRGMDSFAAFE
EVLYLAKQFRCDMVLIAGDLFHDNRPSRRTLYITMEIIRRYCMGPDPVRIQIVSDQAQNF
RNVSGTVNYQDDNYSVDLPIFSIHGNHDDPTRDSHGELLAALDLLAVSNLVNYFGRQEQV
DQVEISPVLIQKGATQLALYGMGSMRDERLNRMWQGKKVRFLRPAEDDEDNEHDTGFFNL
FTLHQNRDLGRGSKNCVQESMIPEWMDLVVWGHEHECLIEFSESVVGTFRITQPGSSVAT
SLVAGEAVRKKVGVVDVQGKNFRMHTVPLTQVRSFVTAELSLQEHRANLDPDDPKIDDKV
TNILEEQVRVLVLNAREKRREILRDARAAGSNAGGRDDDPKGMISPLRYTLKNPDEVLVR
IKVDHSNGFLSLNNQRFGARFVGDVANPSDILLFHRRKDIKQATQQTRAAQKMMQTPIAP
EELEQTHMEDIVKEFLTLPEQKLKLLNETRLSEAMEEFVDKSLTGSINEMAFAQLKQRQK
KLHTTHTASTDIDTEPNVEPEAASKSKSRGSTLARQSNVASTTAAATEVTAKKRRRTAAA
ARAAESSDEDSVEKSPVRQLTRNGKENHRKGRLEADRHGESDDDALEEVPPTRPDSVPPK
RTATSRSTDSSRRKATRRQQLEDEDDLDEQENDRPAPRASAPSRPPRQSRTRVVRYHQED
PDDEDSDSGVEDMPRAGNPVKTTQRVASGRQASTTLRSTAGRGRRAMRSSFGSDGSDEDS
ADDEYRLRNTEDLDDDWGTAATRSQL
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatttggcgccgaatgatgcacgcggcgaggaaaccgcacagagcgtcgctccc
agtgatgtactcgaagatcccgacgaacacacgttgcgcatgatgctctccaccgacaat
catttgggatacgcggagaaagatccggtccgaggaatggactcgttcgccgcctttgaa
gaagtgctctacctggccaaacagtttcgttgcgacatggtgttgattgcgggtgatctc
ttccacgataatcgtcccagtcgtcggacgctttacatcactatggaaatcattcgccgc
tattgtatgggtccggacccggtccgtatacaaatcgtttccgatcaggcacagaacttt
cgcaacgtatcgggaaccgtcaattaccaagacgacaactactccgtcgacttgcccatt
ttcagcattcacggcaatcacgacgatccgacgcgggacagtcacggcgaactgctggcc
gcgctcgacttgctggccgtcagcaacctcgtcaactactttggacgacaggaacaagtg
gaccaggtggaaatatctcccgtgctcatacagaaaggtgccacgcaactggcactctac
ggaatgggcagtatgcgcgacgaacgactcaatcgcatgtggcagggaaagaaagtacgg
tttctgcgacccgccgaagatgatgaggacaacgaacacgataccggctttttcaatctc
tttaccctgcaccagaatcgcgatttgggacgcggctccaaaaactgcgtacaagaatcc
atgattcccgaatggatggatctagtcgtctggggacacgaacacgagtgcctcattgaa
ttttccgaatccgtcgtcggcacctttcgcattacgcaaccgggatcgtccgtagcgacc
agtctggtggccggcgaagctgtgcgcaaaaaagtcggcgtcgtggacgttcagggcaag
aattttcggatgcataccgtgccgttgacccaggtccgatccttcgtcacggcggaactc
tcattgcaggaacaccgggccaacctggatccggacgatcccaaaattgacgacaaggtg
accaacattctggaagaacaggtccgggtgttggtcttgaacgcccgagagaaacgccgc
gaaattttgcgggacgcccgtgcggcgggcagtaacgcggggggacgggacgacgaccca
aagggtatgatctccccactgcggtacacgctcaagaatcccgacgaagtcctggtccgc
atcaaagtagaccactccaacggatttctgtctctcaataaccaacgctttggagcccgt
tttgttggagacgtggccaatccttccgacattttgctgttccaccgccgcaaggatatc
aaacaagctactcagcagaccagggcggcccagaaaatgatgcaaacaccgatcgctccg
gaggaattggagcaaacccacatggaagatattgtcaaggagtttttgactttaccggaa
cagaaactcaagctactgaacgaaacgcgattgagtgaggccatggaagagttcgtcgac
aagtcgttgacgggatccatcaacgaaatggcctttgcacaactcaagcagcgacaaaaa
aagctgcacaccacccatacggcctccacggatatcgataccgaacccaatgtcgaaccg
gaagcggcatcaaaatcgaaatcccgcggttctacgctcgctcgtcaatcaaacgtggcc
tcaacgacggcagcagcgacggaagtgaccgccaagaaacgtcgacgaactgcggctgcg
gcacgcgcagcagagagcagtgacgaggacagcgtagagaagagtccggtgcgacaattg
acgcgtaacgggaaagaaaatcatagaaaaggacgactggaggctgataggcacggcgaa
agcgacgacgacgccttggaggaggttcctccgacgcgtccggattctgtgcccccaaaa
cgaaccgcaacttctcggagtaccgatagttcccggcgcaaggccacacgacgtcagcaa
ctggaagacgaggacgacttggacgagcaggagaacgatcgacccgcgccgcgagccagt
gcgccgagtcgtccgccgcgccagagccggacgcgtgtggtccggtatcaccaagaggac
ccagacgacgaagactcggattcgggcgtggaggatatgccgagggcgggaaatcctgtg
aaaacgacgcaacgggtggcgtccggtcggcaggcgtcgacgacgttgcggtccacggcg
ggccgaggacgccgagcgatgcggagtagttttggctccgacgggagtgacgaggacagc
gcggatgacgaataccgtctacgtaatacggaggacttggacgacgattggggtaccgcg
gccacccgtagtcaactataa

DBGET integrated database retrieval system