KEGG   Phaeodactylum tricornutum: PHATRDRAFT_45308Help
Entry
PHATRDRAFT_45308  CDS       T01075                                 

Definition
(RefSeq) ribokinase
Organism
pti  Phaeodactylum tricornutum
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB AP_endonuc_2 Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 7200013
NCBI-ProteinID: XP_002179509
JGI: 45308
UniProt: B7FX84
LinkDB All DBs
Position
6
AA seq 709 aa AA seqDB search
MLVLRTEALLALFSTLLLTSVCVDASGSRPHRIVVIGSINADTFLPVDRIPIEGENLTLL
PGKLPVVDVPGGKGCTQAVAASKLLAPVGGSVSFVGQFGNDVAAQILQQSLVDAHVDVTF
CSHHENIPSGRGYVFHTTSGQVSAVVSGGSNELGWLEWEHAWEIYNKDRNQILLQGKIDK
LLQDCRLVMLQCEVPEYVNRLVARCAAQRGNILVVQDVGGEDRGMNEEHLRHCDYLMPNE
SELRRLVRSFGGPENDSDIETMAKFLQARGARNILVTQGSKGSTLVADDGTVIHQPAITI
EEVLDETGAGDCYRAAFCTALCEDKSLQQCMEWATAAGACSVERLGAVPSTPTRGQVEDR
VHTNWVERSVLDIPRGDGLGFRGGAKSFPFLIGSRLNSMKDRPELWDGALDDPREYVRRQ
STIKGLTCVDFNFPQHFHTWSNEEAAKSLEMAGLRAGAVCLRYPSKFARGAMNNPDYELR
QEAIELTKHAAQMARDLGAKEVVIWSAYDGYDYPFQVDYDEKWDELVGAFRECCDAYPDI
RFSVEYKPTDENTRFFTIPSTGAALLMVNEVDRQNFGLTLDVGHMLMSGENPGQSIAMVG
RAGKLFGVQLNDGFTRLAAEDGLMFGSVHPSMALEIMYQLRRTKFDGHFYFDTFPQRSDP
VREAEYNIRRVKAFWYAASSMDADRLKRVMDEHDAIGALELVDDSLRRI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtgttacggacagaagctttgttggctttattttcgactcttcttctcacctcg
gtttgcgtcgatgcatccgggagtaggcctcatcggattgttgttattggttccatcaac
gctgataccttccttcccgtcgatcgaataccaattgaaggtgaaaatttgacgctttta
ccgggaaagctcccggtcgtagacgtccccggtggcaaaggctgtacgcaggccgttgcg
gcttctaagttgctagcaccggtgggaggaagtgtttctttcgtcggacaatttggcaac
gacgtggctgcccaaattctgcaacaatcactcgttgacgctcatgtcgacgtcacattt
tgttcgcatcatgaaaatatacccagcggtcgaggctacgtgtttcacacgacatcgggt
caagttagtgccgttgtctcgggtgggagtaacgagctgggatggcttgaatgggagcac
gcttgggaaatatacaataaagatagaaaccagattctgcttcagggaaaaatcgacaag
ctcttgcaagactgtcgtttagtcatgcttcagtgcgaagttccggaatacgtcaatcga
ttagttgctcggtgtgcggcgcagcgtgggaatattctcgtggtgcaagatgttggcggt
gaagaccggggaatgaacgaagagcacctccggcactgcgactatctcatgccgaatgaa
agcgaattgcggcgtctagtgcgatcgtttggtggccccgagaacgactctgacattgaa
acgatggcgaaatttctccaggcccggggtgctcggaatattttggtgacgcaaggaagc
aaaggatctactctagtagcagacgatggtactgtaattcaccagcccgccattacaata
gaagaggtgcttgatgaaacgggcgccggcgactgctaccgtgcagccttttgtacagcc
ttgtgcgaagacaaatctctacagcaatgtatggagtgggcaacggctgccggggcctgt
tcggtagaacgcttaggagctgtacccagtacaccaactcgcggccaagtagaggatcgc
gtccatacgaactgggtggagcgaagcgttcttgatattccaaggggagatggtcttggc
tttcgaggaggggccaagtcctttccatttttgattggatcccgactcaactccatgaag
gatcgaccggaattgtgggacggtgctttggatgatcctcgagagtatgtcagacgccag
tcaacaatcaaaggacttacttgtgtggacttcaactttccacagcactttcacacgtgg
tcgaacgaagaagcggcgaagtccctcgagatggctggattgcgagctggagcagtatgt
cttcggtatccgagcaagtttgcccgaggagccatgaacaatccagattatgaactgagg
caagaagctattgagcttaccaagcacgccgcacaaatggcgagggatcttggcgcaaaa
gaagtggttatatggagtgcttacgatggatacgactatccctttcaagtcgattacgat
gaaaaatgggacgagctagtgggcgcctttcgagagtgttgtgatgcctaccccgatatt
cggttttctgtggagtacaaacctacggatgagaacaccaggtttttcacgataccgagc
acgggagcggctttgctaatggtgaacgaagtagaccgccaaaactttggccttaccctg
gacgtcgggcacatgctgatgtctggtgaaaatcctggacagtcaattgccatggtggga
cgtgcaggaaaactgtttggcgtgcagctcaacgacggctttacccgcttggctgcggag
gacggtcttatgtttggatccgtgcaccccagcatggcgttagagatcatgtaccagctg
cggcgaacgaaatttgatggacacttttattttgacacttttccccagagatcagatcct
gtacgcgaggcagagtacaatattcgaagggtgaaagcattctggtatgctgcctcttcc
atggatgcagaccgactgaaacgcgttatggacgaacatgatgcaattggagccttagaa
cttgtagatgactcattgagaagaatataa

DBGET integrated database retrieval system