KEGG   Phaeodactylum tricornutum: PHATRDRAFT_51040Help
Entry
PHATRDRAFT_51040  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PHATRDRAFT_51040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pti01001]
    PHATRDRAFT_51040
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pti03032]
    PHATRDRAFT_51040
   03400 DNA repair and recombination proteins [BR:pti03400]
    PHATRDRAFT_51040
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PHATRDRAFT_51040
Protein kinases [BR:pti01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   PHATRDRAFT_51040
DNA replication proteins [BR:pti03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     PHATRDRAFT_51040
DNA repair and recombination proteins [BR:pti03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    PHATRDRAFT_51040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC
Motif
Other DBs
NCBI-GeneID: 7201972
NCBI-ProteinID: XP_002181264
JGI: 51040
UniProt: B7G2U4
LinkDB All DBs
Position
12
AA seq 607 aa AA seqDB search
MYRLIHLWFSCEDEGSSNGSLVEIMAEAVTRLPSFRFVPATSQLLSRVEKRNTGSFQETL
HTLILRMCHDHPYNCLVQVVSLANGKTIGSGVSGRQAEVFLENTSDTKVDGANEILASLR
TSERKPLGRLMEGYISLTDAYVHLAMYPTHDFQKAKNKKFPFSAVSKSHAERLDQCLGVG
RRKVPHPPCVLTKPPPIRPASDYTDETGQLIGSESVVGFEQAFSITESGLHRPKIVYCLG
SKGGRFKQLVKGEDEIRQDAVMEQVFGYVNELLSNGDLSDSLDEIRRTTGAGHLRLVTYN
IVPLSPASGVLEWVDHTIPFGEFMMDKKGHVGAHSRYYPGQWSSLVCREQLRKAPKKEKL
QAFNAICLNHSPVFRYFFVERFGHTPELWHEARMRYTRSVAVNSIVGHILGIGDRHCSNI
LIHEGTGEVVHIDFGIVFEQGKLLNTPELVPFRLTQNTVDGFGPVGLDGTFTKSAQRTLS
VLRKNSNALLTILSAIVSDPLYKWSVSPVKARLRQEQQQHQDEEEQGENKRTSMTTTTSS
TKVSRSQGQENEAASHAIRRIQEKLQGYEDGTSGEQQSVEGQVQLLINSAKNKDNLCLMF
CGWAPWV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgattgatacatttatggttctcttgtgaggatgagggaagctcaaatggttcg
ctcgtggaaatcatggctgaagctgtgactcgacttccatcatttcggttcgtaccggca
accagccaacttttgtctcgtgtagaaaaaagaaacacaggctcttttcaagaaactttg
cacacgttgatcctccgaatgtgccacgatcatccttacaattgcctagtacaggtagtt
tcgttggccaatggaaagactataggtagtggtgtcagcggacgacaggcagaggtattc
ctcgaaaatacgagcgacacgaaggttgatggcgcaaatgagattcttgcatcccttaga
acaagcgagcgcaaacctcttgggaggttgatggagggttacatctcgctcactgatgca
tacgtccacttggcgatgtatccaacgcatgacttccagaaggccaaaaacaaaaagttt
cctttttcagcagtcagcaaatcccacgccgaacgcctggaccaatgcctaggcgtggga
cgccgcaaagtgcctcacccaccttgtgtcttgaccaaaccaccgccaattcgtccagca
agtgactacaccgacgaaacggggcagctcattgggtctgagagcgtcgttggttttgag
caagccttttctatcaccgagagcggtctgcatcgccccaagattgtctactgtcttgga
tccaaaggtggtcgttttaaacagctggtaaagggagaggacgagatccgacaggatgcc
gtaatggagcaagtttttggttacgtcaacgaattgttgtcaaacggggatctgtcagac
agcctagatgagatccggcggacgactggagctggccatttgcgtttagtgacttacaat
attgttcctttgagtccagcaagcggggttctagaatgggtcgatcataccattccattc
ggggagttcatgatggacaagaaaggtcacgtcggtgcgcattctcggtattatcctgga
caatggagcagccttgtttgccgggagcagctgcggaaagcaccgaaaaaggaaaaactt
caagcctttaatgcaatttgcttaaaccactcgcccgtctttcgatactttttcgtggag
aggtttgggcacacgccagaattatggcacgaggctcggatgcgctacacgcggtccgtt
gctgtcaatagtattgttgggcacattcttgggatcggcgatcgccactgcagcaacatt
cttattcatgaggggactggggaagtcgtacacatcgattttggtatagtcttcgaacaa
ggaaagctcctgaacacgcccgagctagtgccgttccgactgacgcaaaatacagtggat
gggttcggcccagtgggactcgacggtacctttaccaaatccgcccaacggactttatcc
gttctccgaaagaattcaaacgcgctcctgactattctgtccgcgattgtttcggatccg
ctgtacaaatggagcgtaagtccagtcaaagcacggctgcggcaagagcagcaacagcat
caggatgaggaagaacaaggggagaacaaacgcacatcgatgacaaccacaacgagttcc
accaaagtttcacgtagccaaggacaagaaaacgaagccgcgtcacatgccattcggagg
atacaagaaaaactccaaggctacgaggatggcacatcgggcgagcaacaaagcgtggaa
ggacaggttcagctcctgattaactccgcgaagaacaaggacaatttgtgtctcatgttc
tgtggttgggcgccgtgggtgtaa

DBGET integrated database retrieval system