KEGG   Phaeodactylum tricornutum: PHATRDRAFT_54677Help
Entry
PHATRDRAFT_54677  CDS       T01075                                 

Definition
(RefSeq) DNA polymerase delta
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti03030  DNA replication
pti03410  Base excision repair
pti03420  Nucleotide excision repair
pti03430  Mismatch repair
pti03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pti00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PHATRDRAFT_54677
   03410 Base excision repair
    PHATRDRAFT_54677
   03420 Nucleotide excision repair
    PHATRDRAFT_54677
   03430 Mismatch repair
    PHATRDRAFT_54677
   03440 Homologous recombination
    PHATRDRAFT_54677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pti03032]
    PHATRDRAFT_54677
   03400 DNA repair and recombination proteins [BR:pti03400]
    PHATRDRAFT_54677
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PHATRDRAFT_54677
DNA replication proteins [BR:pti03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    PHATRDRAFT_54677
DNA repair and recombination proteins [BR:pti03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      PHATRDRAFT_54677
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     PHATRDRAFT_54677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_A_exo1
Motif
Other DBs
NCBI-GeneID: 7202225
NCBI-ProteinID: XP_002181135
JGI: 54677
UniProt: B7G220
LinkDB All DBs
Position
12
AA seq 1087 aa AA seqDB search
MIDDDQLFDDDDNNVGIEEEIPAEILAQQAQVVSTVAAKDQQRWKRARLPDDLSNQTDLN
LQWLDMDVVSEGQVPILRGFGVDERGHSIAVFVHGFTPYAYFALENGYELTNLAELSAIR
QTLTARLAAAARGGTATHAEVLGIEYITDHKSIMGYETPHTKFLKIYVSLPGLVPTLKRI
MEDGIDLPGITRTGGTSTGLPPTYAAFEANVPFVLRFMVDRKLSGAGWLTLPSDTYQIRE
IPRKETHCQIEVDISYDDITPRPSEGEWNKIAPLRILSVDIECQGRKGHFPEAEKDPVIQ
IANTISLYGQDKPIVQNVFTLKGCLPIVGAQVICSDEEEDMLMKWRAFLEAADPDIITGY
NVQNFDIPYLLDRADSLSKGSSHRKAVLSGFAQWGRVRNTKAKMRDTMFQSSAYGKRANV
ETTIDGRVIFDMLPYMQRNHKLSSYSLNSVCAEYLGQQKEDVHHSIISDLQNGSDEDRHR
LAVYCLKDALLPQRLMDKLSVLVNYIEMARVTGVPMSFLISRGQQIKVFSMILRKCRHEK
LLVPTLRKSGNANADVGYEGATVLDPIKNYYEVPIATLDFASLYPSIMQAYNLCYSTLVN
PADVGKLDPDIYRKSENGNVFVHSSVKKGILPTILEELLSARKRAKKDMKNAPTDFDRAV
QNGRQLALKVSANSVYGFTGATVGQLPCLPIASSVTSYGRQLLEKTKTFVEEKYTKSNGY
DHDAQVVYGDTDSVMVKFGPATVAETFPLAIEAAEKASEIFPSPILLEFEKVYFPYLLMN
KKRYAGLMWTEIEKYDKLDTKGLEVVRRDNCQLVREVIQTSLNKILIDQNVQGAIEYVKS
QISDLLQNKMDISRLVITKSLNKGAEYALGLGGKKDDYKVKQAHVELAARMKKRDAGSAP
QLGDRVPYIIITGAKGAANFEKAEDPIYVLENNLPIDCKWYLTNQLSKPLTRIFEPIISD
VDKSLLQGDHTRKIFIPTPSARKGSLMMFAKKVAQCIGCKASVDGKKGYLCKHCVNREDA
IYLEKLEILREAELRYNDLWAAAQRIHGTVHSDIICTGDGCSCQFYRRKKVQADIRLAQD
VLDKFAS
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgacgatcagctttttgacgatgacgacaacaacgttgggattgaagaagaa
attccggcagagattctggcgcaacaagcacaggttgttagtacagttgcggcgaaggac
cagcagcgttggaaacgagcccgtctaccggacgacctgagcaaccaaacggatctgaac
ctacagtggctcgacatggatgttgtttcggaaggacaagttccgatcttgcgcggattt
ggtgtggacgaacggggacactctattgctgtttttgttcacggctttaccccttacgcc
tactttgctttggaaaatggctacgaactgacgaatctggccgagctgagtgcgatacgg
caaactcttacggcgcgactagctgctgccgcccgcggcggtacggcaacacacgccgaa
gtcctcggcattgaatacattaccgatcacaagtcgattatgggttacgaaacgccgcac
accaaatttttgaaaatctacgtgtccttgcccggcctggtgccgacgctgaaacgcatc
atggaagacggaatcgatctgccgggcatcacgcgcaccggtggaacgagtacgggtcta
ccacccacatatgcggcctttgaagcgaatgttccgttcgtcctgcgtttcatggtggat
cgaaaactttcgggggctggctggctgaccttgccgtcggacacctaccagattcgggag
attccacggaaggaaacccattgtcagatcgaagtcgacatttcgtacgacgatattact
ccacgaccatcggaaggcgaatggaacaagattgccccgttgcgaattctttcggtcgat
atagaatgtcaaggccgaaagggccactttccggaagcagaaaaagatcctgtcatccag
attgccaacacgatctcgctgtacggtcaagataaacccattgtgcagaacgtctttaca
ctcaaaggctgcttgcccattgttggggctcaggttatttgttccgacgaagaggaagac
atgctcatgaagtggcgagcatttctcgaggctgctgatcctgacattatcacgggttac
aacgttcaaaatttcgacattccctatctcttggaccgtgcggactctttatcgaaaggt
agcagtcatagaaaggcggtgctttccggtttcgcccagtggggacgtgtgcgcaacacg
aaggccaaaatgcgcgacaccatgtttcaatcgtccgcctacggcaaacgcgccaacgtg
gaaactaccattgacggacgagttatctttgacatgcttccttacatgcagcgtaaccat
aagctgagctcgtactcattgaattcggtatgcgcagaatatcttggccaacagaaggaa
gacgttcatcactccattatttctgaccttcaaaacggcagcgacgaagatcgccatcgg
ctggctgtttactgtttgaaggatgctttgctaccacaacgactcatggacaagttgagt
gtcttggtaaactatatcgagatggctcgagtaacgggggttcccatgtcgtttttgatc
tcacgaggccagcaaatcaaggtcttttcgatgattctacgcaaatgccgacacgagaaa
cttctcgttcctaccctgaggaagagcggcaacgccaatgcagatgttgggtacgaagga
gctactgtcctggatcccatcaagaactactacgaagtaccgatagccacattggacttt
gcatccctgtatccatcaatcatgcaagcatacaacctctgttattcgactttggtcaat
cctgccgatgtaggcaagctcgacccagacatctacaggaaaagcgaaaacggtaacgta
tttgttcattctagtgtcaagaagggtattctaccaacaattctcgaggaattgctgagc
gctcgtaagcgagctaaaaaagacatgaagaatgctcccacagatttcgatcgagcggta
caaaatggtcgccagctagcgttaaaggtgtctgccaactctgtatacggtttcacgggt
gctactgtcggacaactcccgtgtctcccaattgcatcatcggttacatcgtatggacgc
caactgttggaaaagaccaaaacctttgttgaggagaaatacacgaagtcaaatggctat
gaccacgacgcccaggtcgtatacggggacacagatagcgtaatggtaaagtttggtcca
gcaacggtcgcggaaacgtttccattggcgatcgaagctgctgaaaaagcttccgagatt
tttccgagtccaattcttttggagtttgaaaaggtttattttccttacctcctcatgaac
aaaaaacgctacgctggtctgatgtggacagaaattgagaagtacgacaagttggacaca
aagggattggaagtggtgcgtcgagacaactgtcagctggtccgtgaagttattcagacg
tcattaaacaagatattgatcgatcaaaatgttcaaggggctatcgagtacgtcaagtct
cagatctccgatttactacaaaacaagatggacatttcacgtctggtcattacaaaatct
ctcaataaaggggctgaatatgctcttggtctcggtgggaagaaagacgattacaaagtc
aagcaggctcatgtagagcttgccgcgcgaatgaaaaaacgggatgccggatcagcgcca
caacttggtgatcgtgttccatacataattatcacgggtgccaaaggagctgcgaatttc
gaaaaggctgaagatcctatctacgtactggaaaacaatctaccaatagattgcaagtgg
tacttgacaaaccagctgtcgaagccgttgactcgtatcttcgaacctatcatttcagat
gttgataaatccttactccagggagatcacactcgcaagatctttattccaactccaagc
gccaggaaaggtagcttaatgatgttcgccaagaaggtagcacaatgtattggctgcaag
gcaagcgtggatggtaagaaaggctacttgtgcaaacactgcgtaaatcgagaagatgca
atctatttggagaagttagaaattttgcgtgaagccgaacttcgctacaatgatttgtgg
gcagctgcgcagcgtatccatggtactgtgcattcggacattatttgtacgggagacggt
tgcagttgtcagttttaccgtcgaaagaaagttcaagctgatatacgccttgctcaagac
gtccttgacaagtttgcttcttga

DBGET integrated database retrieval system