KEGG   Phaeodactylum tricornutum: PHATRDRAFT_55157Help
Entry
PHATRDRAFT_55157  CDS       T01075                                 

Gene name
FABZ_2
Definition
(RefSeq) 3R-hydroxyacyl-[acyl carrier protein] dehydrase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00061  Fatty acid biosynthesis
pti00780  Biotin metabolism
pti01100  Metabolic pathways
pti01212  Fatty acid metabolism
Module
pti_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PHATRDRAFT_55157 (FABZ_2)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PHATRDRAFT_55157 (FABZ_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pti01004]
    PHATRDRAFT_55157 (FABZ_2)
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PHATRDRAFT_55157 (FABZ_2)
Lipid biosynthesis proteins [BR:pti01004]
 Fatty acid synthase
  Component type
   PHATRDRAFT_55157 (FABZ_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas
Motif
Other DBs
NCBI-GeneID: 7198895
NCBI-ProteinID: XP_002185095
JGI: 55157
UniProt: B7GDA8
LinkDB All DBs
Position
27
AA seq 197 aa AA seqDB search
MKIVRVTTLLLSLVFTTAFVVDRPTVARTSTARADTPHGARDISARSETLDTVYTSEQID
ALLPHRYPFALVDKVVEYDAGKRAVGIKCVTKNEEFFNGHFPGRPIMPGVLQVEALAQLA
GIVCLQMDGATPGAVFFFAGVDGVKWKRPVVPGDVLVMEVEIKKWKAKFGIAKATGRAYV
DGQLVVEVDEMTFALAK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgttcgtgttactacgctactactatcgctcgtcttcacgacggcttttgtc
gtggaccgacctacggtcgctcgcacatcgacggcacgcgccgacacaccgcacggcgcc
cgggacatttccgcccgttcggaaactctcgacacggtgtacacctcggagcagatcgac
gccctcttgccgcaccgttacccctttgccctcgtcgataaggtcgtcgagtacgatgcc
ggcaaacgtgccgtcggtatcaagtgtgtcaccaagaacgaagagttcttcaacggacac
ttccccgggcgtcccattatgcccggtgtactgcaggtggaggctctcgcacagctcgcc
ggcattgtctgtctccaaatggacggtgccacacccggtgccgtctttttctttgccgga
gtcgatggcgtcaagtggaagagacccgtagtgcccggagacgtactcgtcatggaagtc
gaaatcaaaaaatggaaggccaagttcggaattgccaaggccaccggccgagcctacgtc
gacggacaactcgtcgtggaagtagacgaaatgacctttgccctggccaagtaa

DBGET integrated database retrieval system