KEGG   Phaeodactylum tricornutum: PHATRDRAFT_56501Help
Entry
PHATRDRAFT_56501  CDS       T01075                                 

Gene name
ME1
Definition
(RefSeq) hypothetical protein
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00620  Pyruvate metabolism
pti00710  Carbon fixation in photosynthetic organisms
pti01100  Metabolic pathways
pti01200  Carbon metabolism
Module
pti_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PHATRDRAFT_56501 (ME1)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PHATRDRAFT_56501 (ME1)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     PHATRDRAFT_56501 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 7197107
NCBI-ProteinID: XP_002177890
JGI: 56501
UniProt: B7FRZ7
LinkDB All DBs
Position
2
AA seq 638 aa AA seqDB search
MISSACRGSLKSLCSVQLRSNTRQHASLISCNNSPNVKRFSTAFSSQTDGEVLTVGGALS
GEEPIHETGEWAGCKRSFMIPIRISVRGTDILLDPLYNKGTAFKTGERDRLRFRGMLPHR
IMNIHLQKERFLQALRAEDSNIRKNVMLEDLHDRNETLYHRVLVDHIEEMAPYIYTPTVG
QACMEFATRYRRPRGMYFTEEDRGHMAAMVYNWPHRDVHVICVTDGSRILGLGDLGANGM
GIPIGKLALYCAAGGIAPHRVLPVVFDAGTNNEALLQDKYYLGVQRKRLKGAAYFRMMDE
FMDAVRFRWPNVLVQFEDFSSEVAQTLLDRYRDDHLCFNDDIQGTGATTLAGVLGALRAK
GEEVTSLGDQRIVIAGAGSAGIGIAQVLMQAMEEQGRTPEEAKNAFYILDQNGLLGTDRA
NDLNAEQRVFVRSADNNLSLMDVVKKYKPTILLGVTTVGGLFTGDLIREMHSSCERPIIF
PLSNPTNKAECTAEQAYEWTNGQCIFASGSPFDTIEFEDGRVFYPSQCNNMYVFPGLGLG
ASVCGAQKVTDRMLYVAAETLANFVSKKDMEEGRLFPQLTRIREVSHRIAVAVVEEALRE
GLATKVKPADANDLDSFVGRKMYFPEYVPLVEKREISI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgatatcatcggcgtgtcgtggcagcctgaaatccctctgtagcgtccaactgaggagc
aatactcgccaacatgcgtcgttgatcagctgtaacaattctcctaacgtgaagagattt
tctactgcctttagcagtcagacagacggagaggtcttgactgtcggtggcgctctctca
ggggaagaacccatacacgagacaggagaatgggccggctgcaagagaagctttatgata
ccaataaggatttcggtccgtggcaccgatatcctgcttgatcctttatacaacaaagga
actgcgtttaaaacgggtgaacgcgatcgtcttcgatttcgcggtatgcttccacatcgt
attatgaacatccatttgcaaaaagagcgattcctgcaggccttacgcgctgaagatagc
aacattcgtaagaacgtcatgctcgaagacctacacgatcgcaatgaaaccctttaccat
cgggtattggtcgatcacattgaggagatggctccttatatttacacacctaccgttggg
caggcttgtatggagttcgcgacacggtatcgtcgtccgcggggtatgtacttcacagaa
gaagatcggggtcatatggccgcgatggtttacaactggccgcaccgggatgtccacgtg
atttgtgtgacggacggcagtcgtatccttggtcttggtgatctgggtgccaacggtatg
ggaattccaattgggaaactagccttgtactgtgctgccggtgggattgcaccacatcgg
gtgttgccggttgtttttgatgctgggaccaacaatgaagctctgttacaggacaagtat
tatctcggtgtgcaaaggaaacgattgaaaggtgcagcttacttccgtatgatggatgag
ttcatggatgcggttcgctttcgatggcccaatgtattggtgcagtttgaggatttttcg
agcgaagtcgcccaaaccctactggatcgctacagagacgatcatctttgctttaacgat
gatatacagggaacgggtgcaaccacgcttgcgggtgtacttggagctcttcgcgccaag
ggggaagaggttacatctttaggtgatcaacgtattgtcattgctggtgcgggtagtgcc
ggtataggtatcgcccaagtcttgatgcaagcaatggaagagcaaggacggacaccagag
gaagccaagaacgcattctatattctcgatcagaacgggcttctgggtactgaccgtgcc
aacgacttaaatgctgaacagcgcgtgtttgtgagatctgccgacaacaacctgtcgctg
atggatgtggtaaaaaaatacaaacctacgatccttctcggcgttacaacagtcggtgga
ttgttcactggagacctaattcgggagatgcactctagttgcgagcgccctataatattt
ccgctttccaacccgacaaacaaggctgaatgtacagcagagcaagcttacgaatggaca
aacggacaatgcatctttgcatcggggtcgccattcgatacgatcgagttcgaagatggc
cgcgttttctatccctcccaatgcaacaacatgtatgtattcccgggtctggggctggga
gcatcagtttgcggtgctcaaaaagttacagaccgcatgctctacgtcgcagcagaaacg
ttggctaattttgtttccaaaaaggacatggaggaggggcgtctttttcctcaactgaca
agaattcgtgaggtctcgcaccgtattgccgtagcagttgtggaggaagccctgcgggag
ggcttggcgacaaaggtaaaacctgccgatgccaatgatctggattcttttgttgggcga
aaaatgtacttccccgagtatgttcctttggtggaaaaacgagaaatatcaatctag

DBGET integrated database retrieval system