KEGG   Phaeodactylum tricornutum: PHATR_41812Help
Entry
PHATR_41812       CDS       T01075                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase flavoprotein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00020  Citrate cycle (TCA cycle)
pti00190  Oxidative phosphorylation
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01130  Biosynthesis of antibiotics
pti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHATR_41812 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PHATR_41812 (SDH1)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PHATR_41812 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 7204112
NCBI-ProteinID: XP_002186498
JGI: 41812
UniProt: B5Y5N6
LinkDB All DBs
Position
3
AA seq 638 aa AA seqDB search
MPKTRRKPTTKIRDLHRRVAVTSVGSKSLSTSPHLIGDYTVIDHTYDAVVVGAGGSGLRA
AMGLSEAGFKTACVTKLFPTRSHTVAAQGGINAALGNMGEDDWRWHMYDTVKGSDWLGDQ
DAIHYMCREAPKAVLELEEFGMPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCAAAADRT
GHAMLHTLYGRSLAFDTTYFIEYFAMDLLMNDQGECVGVVALNMEDGTIHRIHAKNTVLA
TGGYGRTYFSCTSAHTCTGDGNAMAMRQGLSNQDNEFVQFHPTGIYGAGCLITEGCRGEG
GILRNSEGERFMERYAPSAKDLASRDVVSRSMTMEIREGRGAGPKKDHIYLHLDHLPPDL
LAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHYGEVIRTKFDKDGNFSKD
EVVPGLFASGESACASVHGANRLGANSLLDIVVFGRACANRIAEIAKPGDKIADGPSDVG
FGSIAELDKLRYAEGHATTADIRSEMQSVMQEHAAVYRTTQTLAEGKTAIDGVVDKFKDI
AVTDKSLVWNTDLVETLELRNLLACASTTMYGAENRKESRGAHAHEDYPTRDDENWMKHT
LSYFDESTGRTEIKYRPIHYYTLDEDECKTVPPVARVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaacacgccgtaaaccaactacgaaaatccgtgatttgcaccgacgcgtcgcc
gtcacttccgtcggatcgaaatctctgtcgacttcacctcatttgattggtgattacacc
gtaattgatcacacgtacgatgccgtcgtcgtcggtgccggcggctccggattgcgtgcc
gccatgggcctgtccgaagccggattcaagactgcgtgtgtgaccaaactcttccctaca
cgcagtcacaccgttgccgcgcaaggaggcatcaacgctgcgttgggaaatatgggcgag
gatgattggcgctggcacatgtacgataccgtcaagggtagtgattggttgggtgatcaa
gacgccattcattacatgtgtcgagaggctcccaaagcagttttggaactggaggaattc
ggtatgcccttttcccgtaccgaagaaggcaaaatttaccaacgtgcctttggcggacag
agtctggatttcggtaagggtggacaggcctaccgctgtgcggccgccgccgatcgtacc
ggccacgccatgctgcacacgctctatggacgttctctcgccttcgatacgacatacttt
attgaatacttcgccatggatctactcatgaacgatcaaggtgaatgcgtcggagttgtg
gccctcaacatggaagacggcaccattcatcgcatacacgccaagaataccgtcctggcc
acgggtggctacggacgaacctacttctcgtgcacctccgctcacacgtgcacgggcgac
ggtaacgccatggccatgcggcagggcctgtccaaccaggacaacgagtttgtgcagttc
catccgaccggaatttacggagctggctgtctcatcacggaaggctgtcgcggagaaggt
ggtattctgcgcaattctgaaggtgaaagattcatggagcgatatgccccgtcggccaaa
gatctggcatcgagagacgtcgtttcacgttccatgaccatggaaatacgcgagggacgg
ggtgcaggtccaaagaaggatcacatctatctacacttggatcatcttcctccggatctc
ttggcagaacgattgcctggaatcagcgagacggctgccattttcgccggtgttgacgtg
accaaggagcctattcctgttttgcctacagttcattacaacatggggggtatcccgacc
aatcactatggggaagttatccgaaccaagtttgataaggatggaaacttttccaaagac
gaggttgttccgggactctttgcatcgggtgaatctgcgtgtgcttccgttcacggtgcc
aatcggttgggagccaactctttgctagacattgttgtctttgggcgtgcttgtgccaac
cgcattgccgaaatcgcaaaacccggggacaagattgccgatggtccttccgatgttggt
tttggtagcattgccgaactcgacaagcttcgatacgcggaaggacatgccacaactgcc
gatattcgctccgaaatgcaaagcgtgatgcaggaacacgctgccgtctaccgcactacc
cagacgctggcggaaggaaagaccgccattgacggcgtcgttgacaaattcaaagacatt
gccgtgactgacaagtctctggtgtggaacacggatttggtcgaaactttggagttgcgc
aacttattggcctgcgcatcgaccaccatgtatggtgccgagaatcgcaaggaaagtcgg
ggtgcccatgctcatgaagattatcccacgcgtgacgacgaaaattggatgaagcacaca
ttatcttactttgacgaaagcactggacggaccgaaatcaaataccgtccaatccattac
tacactctggacgaagatgaatgtaaaactgtccctccggtagctcgtgtttactga

DBGET integrated database retrieval system