KEGG   Phaeodactylum tricornutum: PHATR_46880Help
Entry
PHATR_46880       CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PHATR_46880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pti02000]
    PHATR_46880
Enzymes [BR:pti01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PHATR_46880
Transporters [BR:pti02000]
 Other Transporters
  Pores ion channels [TC:1]
   PHATR_46880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_C_5 GST_C GST_N_4 GST_C_3 GST_N Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 7204724
NCBI-ProteinID: XP_002185767
JGI: 46880
UniProt: B5Y428
LinkDB All DBs
Position
11
AA seq 576 aa AA seqDB search
MTIRIQPTVPSPKIYYYSYCYCWWYMGLVTLAVSCILRPPALLVHGWATTPTRVLGIVGR
TSALVASSAETTRHRHGASLSMSQSPSSSSFGSILGNLVSSSWNRSNSGPSAVPGLDQAL
IESPRSSWNEIRSLLESRMTTNAERNFRNNLSTGYGVASPLHNVRLYDEANQESDVRVTF
YRDSASWCPYCQKVWMTLEEKRIPYRVERVNMRCYGDKPASFFRIQPGGQIPVAVIDGKV
YGQSNDILYALEEAFPQHKSLAPPQGMAMEAQRLLRLERSLFSVWMYWLTGGRQRDEFRA
TLAEVETALAQNTDGPFFLGRDVTMVDCMFAPFLERMAASLLYFKGFQFRVAPGVPTDYP
AINAWFDAMETRESYQLTKSDYYTHCWDLPPQLGGCVYEKGGEPFEQAINGDRRLDGTHK
SWELPLAPHNGGIEPDWEWAGDEAAARREAVERVSANHQAIVKFAARGAGTKGLVPFSAP
LADPKATPNEAVLQAVDTCLQIVCLALLEGTDKYDTDMVKVAHIIQEKGGQEFTNGVVAS
LAYLRDRVGVPRDMRLPAARQLRAHLNWSVGKLLDT
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcgtatccaacccaccgtcccctctcccaagatctactactactcctactgc
tactgctggtggtacatgggtctcgtgacactcgccgtttcttgtattctgcgtccacca
gcactgctggtccacggttgggcgacgactcccacgcgcgtgttggggattgtgggtcgg
acgtccgcactcgtcgcgagtagtgccgagactacccgtcaccgtcacggtgcttccttg
tccatgagtcaatcgccgtcatcgtcgtcgttcggatccatccttgggaacctggtgtcg
tcgtcgtggaacagaagcaacagcggtccgtcggcggtgcccgggctcgatcaagccttg
atcgaatcaccacgttcttcctggaacgaaattcgatccctcttggaatcccgaatgaca
accaatgcggaacggaactttcggaacaatctgtctacaggatacggcgtcgcttcccca
ctgcacaacgttcgattgtacgacgaagccaaccaggaatccgacgtgcgcgttaccttt
tatcgagacagtgcgtcctggtgtccctactgtcaaaaggtgtggatgacactggaagaa
aaacgcatcccgtatcgagtggaacgtgtcaatatgcgctgttacggggataagccagcc
tccttcttccggatccagcctggagggcaaatccccgtggccgtcattgacggcaaggtc
tacggacaatccaacgacattttgtacgctctcgaggaggcctttccgcaacacaaatct
ctcgctccaccccagggcatggcaatggaagcacaacgactgttgcgattggaacgcagt
ctcttctcggtctggatgtactggttgacgggtggtagacagcgcgacgagtttcgggca
acacttgccgaggtcgaaacggccttggcacagaatacggacggaccgttctttctgggt
cgggacgtgaccatggtggattgcatgtttgcgccctttttggaacgcatggcggcgtca
ctcttgtacttcaaaggctttcaattccgggttgctcccggtgtcccgacggactatccc
gccatcaacgcctggttcgacgccatggaaacacgggaaagttatcaactgaccaagagt
gattactacacacactgttgggacttaccgccccaactgggcggttgtgtctacgaaaaa
ggtggcgagccctttgaacaagccatcaacggcgaccgtcggttggacggcacgcacaag
agttgggagttgccgctggcgccgcacaacggagggattgaaccggactgggaatgggcc
ggtgacgaggcggcggcccgacgggaggcggtggaacgcgtgtccgccaatcaccaagcc
attgtcaagtttgccgcccgtggagccggcaccaaaggactcgtgcccttttcggcaccc
ctcgccgatcccaaggcgacacccaacgaagccgtcctccaggccgtggacacatgttta
cagattgtttgcctggcgttgctggaagggaccgacaagtacgataccgacatggtcaag
gttgcgcatattattcaggaaaaaggcggccaggagttcaccaatggcgttgtcgccagt
ctcgcatatttgcgagatcgtgtgggtgttccacgggacatgcgcttaccggcagctcgg
cagttgcgggcacacctgaattggtccgtgggcaagcttttggatacataa

DBGET integrated database retrieval system